KEGG   Delphinapterus leucas (beluga whale): 111175188
Entry
111175188         CDS       T05885                                 

Gene name
FLT1
Definition
(RefSeq) vascular endothelial growth factor receptor 1 isoform X1
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04066  HIF-1 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle05202  Transcriptional misregulation in cancer
dle05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111175188 (FLT1)
   04014 Ras signaling pathway
    111175188 (FLT1)
   04015 Rap1 signaling pathway
    111175188 (FLT1)
   04066 HIF-1 signaling pathway
    111175188 (FLT1)
   04020 Calcium signaling pathway
    111175188 (FLT1)
   04151 PI3K-Akt signaling pathway
    111175188 (FLT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111175188 (FLT1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111175188 (FLT1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111175188 (FLT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111175188 (FLT1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111175188 (FLT1)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   111175188 (FLT1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig V-set VEGFR-2_TMD Ig_6 Ig_4 Ig_5 C1-set
Other DBs
NCBI-GeneID: 111175188
NCBI-ProteinID: XP_022430265
UniProt: A0A2Y9N7N5
LinkDB
Position
Unknown
AA seq 1340 aa
MVSCWDTGALLCALLGGLLLTGCSSGSKLKGPELSLKGTQHVMQAGQTLYLKCRGEGAHS
WSLPATVNKESQSRRLSITKSACGRSGKQFCSTLTLNAAQANHTGFYSCKYLSTPASKKK
KAESTIYIFINDTGRPFLEMHSEIPEIVNMTEGKEVVIPCRVTSPNITVTLKKFPFDTLI
PDGKRITWDSRKGFIISNATYKEIGLLTCETTVNGHEYKTNYLTLRQTNTITDVQISTPS
PVRLLRGHALTLNCTATTPLNTRVQMTWSYPGEINKRASIRQRIDRRNSRNNVFYSILLI
DKVQNKDKGLYICHVKSGPSLKSVNTSVHIYDKAFITVKPRQQQVFETVAGTRSYRLSVK
VKAFPSPEVVWLKDGLPATEKSARYLVRGYSLIIKDVTAEDAGDYTILLGLKQSNVLKNL
TATLIVNVKPQIYEKAVSSFPYPTLYPLGSRQILTCTIYGIPQPTITWFWHPCNHNHSKA
RYDFCSNNEESFILDPDSTVGNRIESITQRTAVLEGKNKTASTLAVADSRISGIYSCMAA
NKVGTVERNINFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDITWILLRTVNNR
TMQHSIRKQKTAVTKEHSVTLHLVIKNVSLEDSGTYACRARNMYTGEEILQKKEVTIRDQ
EAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFI
ERVTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTL
FIRKLKRSSSEMKTDYLSIIVDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAF
GKVVQASAFGIKKSPACRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGAC
TKQGGPLMVIVEYCKHGNLSNYLKSKRALFLLNKDAALHVEPKKEKMEPDLEQGEKQRLD
SVTSSESFASSGFQEDKSLSDAEEEEDSDDFYKQPITMEDLISYSFQVARGMEFLSSRKC
IHRDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKSYST
KSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLKDGMRMRAPEYATPEIYQIMLDCWH
KDPKERPRFAELVEKLGDLLQANVQQDGKDYIPLNAILTGNSGFTYSTPAFSEDFFKEDI
SAPKFNSGSSDNVRYVNALNFISLEKIKTFEELSPNATSMLDDYQLDSGTLLASPLLKRF
TWAESKPKASLKIDLRVTSTSKESGLSDLSRPAFCHASCGHLSRGRRRFTYDPSELERKI
SCCSPPPDYNSVVPYSTAPV
NT seq 4023 nt   +upstreamnt  +downstreamnt
atggtcagctgctgggacaccggggccctgctctgcgcgctgctcggcggtctgcttctc
acaggatgtagttcaggttcaaaattaaaaggtcctgagctgagtttaaaaggcacccag
cacgtgatgcaagcaggccagacgctgtatctcaaatgcagaggggaaggggcccattcc
tggtctttgcctgcaacagtgaataaggaaagccaaagccggaggctgagcataactaaa
tctgcctgtggaaggagtggcaagcagttctgcagtactttgactctgaacgcggctcag
gcaaaccacactggcttctacagctgcaagtatctctctacacctgcttccaagaaaaag
aaagcagaatctacaatctacatatttattaatgatacaggtagacctttcttagagatg
cacagtgaaatcccggaaattgtaaatatgaccgaaggaaaggaggtcgtcatcccctgc
cgggttacatcacccaacatcactgttactttaaaaaagtttccatttgatactctgatc
cctgatggaaaaagaataacgtgggacagtaggaagggctttataatatcaaatgcaaca
tacaaagaaatagggcttctgacctgtgaaacaacagtcaacggacatgagtacaagaca
aactatctcacacttcgacaaaccaacacaatcacagacgtccaaataagcacgccaagc
ccagtcagattacttagaggtcatgctctcaccctcaactgcacggccaccactcccttg
aacacaagagttcagatgacctggagttaccctggggaaataaataagagagcctctata
aggcaacgaattgaccgacgcaattcccgtaacaatgtattctacagcattcttctcatt
gacaaagtgcagaacaaagacaaaggactttacatttgtcacgtgaaaagcggcccgtca
ttgaaatccgttaacacctcagtgcatatatatgataaagcgttcatcacagtgaaacct
cgacagcagcaggtgtttgagactgtagctggcacgcggtcttatcggctctctgtgaaa
gtgaaggcgtttccctcgccagaagttgtatggttaaaagatgggttaccagccactgag
aaatctgcccgctacttggttcgtggctattcgttaatcatcaaagatgtgactgccgaa
gatgcaggggattacacgatcttgctgggcctaaagcagtcaaatgtgttaaaaaacctc
actgccactctgattgtcaatgtgaaaccccagatttatgaaaaggctgtatcatcgttt
ccatacccgactctctacccactgggcagcagacaaatcctgacttgcaccatttacggt
atccctcaacctaccatcacgtggttctggcatccctgtaaccataatcattccaaagca
aggtatgacttttgctccaataatgaagagtcctttatcctggatcctgacagcaccgta
ggaaacagaattgagagcatcactcagcgcacggcagtcttagaaggaaagaataagacg
gctagcaccttggctgtggccgactctagaatttctggaatctacagttgcatggctgcc
aataaagtagggactgtggaaagaaacataaacttttacatcacagatgtgcccaatgga
tttcacgttaacttggaaaaaatgcctacggaaggagaggacctgaaactgtcttgcaca
gttaacaagttcttatacagagacattacctggatcttgctgcggacagtaaacaaccga
accatgcagcacagcatccgcaagcagaaaacggccgtcacgaaagagcactccgtgaca
ctccacctcgtcatcaagaacgtttccctggaagactcgggcacctatgcctgccgagcc
aggaacatgtacacaggggaagaaatcctccagaagaaagaagtgaccattagagatcag
gaagcaccctacctcctacgaaacctcagtgatcacacagtggctatcagcagttctacg
actttagattgtcacgctaacggtgtcccagagcctcagataacctggtttaaaaacaac
cacaaaatacaacaagaacctggaattattttaggaccaggaagcagcacgctgtttatt
gaaagagtcacggaagaggatgaaggtgtctatcactgcaaagccaccaaccagaagggg
tccgtggagagttcggcatacctcaccgtgcaaggaacctcagacaagtctaatctggag
ctgatcactctgacgtgtacctgtgtggctgcaaccctcttctggctcctgttaactctc
tttatccgaaaactgaaaaggtcttcttccgagatgaaaactgactacctatcgattatc
gtggacccagatgaagttcccctggatgagcagtgcgaacggctcccttacgatgccagc
aagtgggagtttgcccgggagagacttaaactgggcaaatcacttggaagaggggctttt
ggaaaagtggtccaagcgtctgcattcggcattaagaaatcacccgcctgccggacggtg
gccgtcaagatgctgaaagagggggccacggccagtgagtacaaggctctgatgaccgag
ctcaagatcttgacccacatcggccaccacctgaatgtcgtcaacctgctgggagcctgc
accaagcaaggagggcctctgatggtgattgtggaatactgcaaacacggaaatctctcc
aactatctcaagagcaaacgggccttattccttctcaacaaggatgcagccttacacgtg
gagcctaagaaagagaaaatggagccagacctggagcagggtgagaaacaaagactagac
agtgttaccagcagcgagagcttcgcaagctccgggtttcaggaggataaaagtctgagt
gatgccgaggaagaggaggattctgacgatttctacaagcagcccatcactatggaagat
ctgatttcttacagttttcaagtggccagaggcatggagtttctgtcttccagaaagtgc
attcatcgggacctggcagcacgaaatatactgctgtctgagaacaacgtggtgaagatt
tgtgattttggccttgcccgggatatttataagaaccccgattacgtgagaaaaggagat
actcgacttcctctgaagtggatggctcccgaatccatctttgacaaaagctacagcacc
aagagcgacgtgtggtcttacggagtactgctgtgggaaatcttctccttaggtgggtcc
ccgtacccgggcgtgcagatggacgaggacttctgcagccgcctgaaggacggcatgagg
atgcgggccccggagtacgccacgcccgaaatctaccagatcatgttggactgctggcac
aaagacccaaaagaaaggccaagattcgcagaacttgtggaaaaactaggcgacttgctt
caagccaatgtacaacaggatggcaaggactatatcccactcaatgccatactgacagga
aatagtgggtttacgtactcaactcctgccttctcagaggacttcttcaaggaagatatt
tctgctccaaagtttaattcaggaagttctgataatgtcagatatgtaaatgctctcaat
ttcatcagcctggaaaaaatcaaaacctttgaagaactttcaccaaatgccacgtccatg
cttgatgactaccagctggacagtggcaccctgctggcctctcccttgctaaagcgcttc
acctgggccgagagtaaacccaaagcctcactgaagattgacttgagagtaacaagtaca
agtaaggagtcgggcctttctgacctcagcagacccgcgttctgccatgccagctgtggg
cacctcagcagaggccggcgcagattcacctatgacccctcggagctggagaggaagatt
tcgtgctgctctcccccacccgactacaactccgtggtcccgtactccacggcacccgtc
tag

DBGET integrated database retrieval system