KEGG   Delphinapterus leucas (beluga whale): 111175243
Entry
111175243         CDS       T05885                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04152  AMPK signaling pathway
dle04218  Cellular senescence
dle04914  Progesterone-mediated oocyte maturation
dle05161  Hepatitis B
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    111175243 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111175243 (CCNA1)
   04218 Cellular senescence
    111175243 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111175243 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111175243 (CCNA1)
   05202 Transcriptional misregulation in cancer
    111175243 (CCNA1)
   05203 Viral carcinogenesis
    111175243 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111175243 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111175243 (CCNA1)
   05161 Hepatitis B
    111175243 (CCNA1)
   05169 Epstein-Barr virus infection
    111175243 (CCNA1)
   05165 Human papillomavirus infection
    111175243 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dle03032]
    111175243 (CCNA1)
   03036 Chromosome and associated proteins [BR:dle03036]
    111175243 (CCNA1)
DNA replication proteins [BR:dle03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    111175243 (CCNA1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    111175243 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 111175243
NCBI-ProteinID: XP_022430382
UniProt: A0A2Y9NBT5
LinkDB
Position
Unknown
AA seq 421 aa
MHLSSSKSGVVLAPVSRGPDACQMITRAQLGQDLPQRTVLGVLTENGQYRRTCGQGITAL
RCFSGSENVFPPAGKKALSASGVQGPAKQGFDMYVDEPEQGDRDNCTGREGMAFEDAYEV
DTRTLKSDLHFLLDFNTVSPMLVDSSLYSQSEDASDFGTDVINVTEYAEEIHQYLREAEI
RHMPKVHYMRKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAALLLASKYEEIYPPGVDEFVFITDDTYTKQQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRYFW
PETLATFTGYSLREIVPCLSELHKVCLGIPHRPQQAIREKYKASKYMHVSLVEPPAVLPL
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcatctcagcagctccaagagtggagtagtgctggctccagtgtcccgaggtcctgat
gcctgtcagatgataaccagagcccagcttggccaggatctgccacaaagaacagtacta
ggggtgctaactgagaatgggcagtacaggaggacctgtggccaggggatcacagcactc
aggtgtttctctgggtcagaaaatgtcttccctccagctggaaagaaagcgctgtctgcc
agcggggttcaggggccagccaagcaaggatttgacatgtacgtggacgagcctgagcaa
ggggacagagacaactgcacagggcgagaggggatggcatttgaggatgcctatgaagta
gacaccagaacactcaagtcagaccttcacttcctgctggattttaacacagtttcccct
atgctggtagattcatctctctactcccagtctgaagatgcatcagattttggtacagat
gtgataaatgtgactgaatatgctgaagaaattcatcaataccttagagaagctgaaata
agacacatgcccaaagtgcactacatgaggaaacaaccagacatcacagaaggcatgcga
acgattctggtggactggctggttgaggtgggagaagaatataagcttcgggcagagact
ctctacctggccgtcaacttcctggacaggtttctttcctgcatgtctgttctgagaggg
aaactgcagcttgtcggaacagcagctcttctcctggcttcgaaatatgaagaaatatat
ccacctggagtagatgagtttgtctttataactgatgatacctacacaaaacaacaactg
ctgagaatggaacacctgctcctgaaggtcctggcttttgacctgacagtgccaaccacc
aaccagtttctccttcagtacttaaggaggcaaggggtgtgtgtcaggactgagaaccta
gccaagtatgtagcagagctgagtctccttgaagctgacccgttcttgaaataccttcct
tcactgatcgctgcagctgcttactgcctggcaaactatactgtgaacaggtacttctgg
ccagaaacccttgctacgtttacaggctattcattacgtgaaattgtgccttgcctgagt
gagctgcataaagtgtgcctgggtattccccaccgacctcagcaagcaattagggagaag
tacaaggcttcaaagtacatgcacgtgtctctcgtggaaccacccgcagtccttcctcta
cgataa

KEGG   Delphinapterus leucas (beluga whale): 111186072
Entry
111186072         CDS       T05885                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04152  AMPK signaling pathway
dle04218  Cellular senescence
dle04914  Progesterone-mediated oocyte maturation
dle05161  Hepatitis B
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    111186072 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111186072 (CCNA2)
   04218 Cellular senescence
    111186072 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111186072 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186072 (CCNA2)
   05202 Transcriptional misregulation in cancer
    111186072 (CCNA2)
   05203 Viral carcinogenesis
    111186072 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111186072 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111186072 (CCNA2)
   05161 Hepatitis B
    111186072 (CCNA2)
   05169 Epstein-Barr virus infection
    111186072 (CCNA2)
   05165 Human papillomavirus infection
    111186072 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dle03032]
    111186072 (CCNA2)
   03036 Chromosome and associated proteins [BR:dle03036]
    111186072 (CCNA2)
DNA replication proteins [BR:dle03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    111186072 (CCNA2)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    111186072 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111186072
NCBI-ProteinID: XP_022451994
UniProt: A0A2Y9PYW9
LinkDB
Position
Unknown
AA seq 432 aa
MLGSSAPGPAAREAGSALLTLQQTALQEDQENINPEKAAPTQQSRTRAGLAVLKAGNSRG
PAPQQRPKTRRVAPLKDLPINDEHVTVPPWKANSQQPAFTIHVDEAEEETQKRPVESKKP
ESEDVLAFNSAVTLPGPRKPLAPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLAFDLAAPTINQFLTQYFLHQQSANCKVESLAMFLGELSLIDADPYLKYLPSVTAAAAF
HLALYTVTGQSWPESLVQKTGYTLETLKPCLMDLHQTYLRAPRHAQQSIREKYKNSKYHG
VSLLNPPETLNV
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgttgggcagctccgcgcccgggcctgcggcccgcgaggcaggctcggcgctgttaaca
ttgcagcagacggcgctccaggaggaccaggagaacatcaaccccgagaaggcggcgccc
acccagcagtcccggacccgcgctgggctggcggtactgaaggccgggaactcgcgggga
ccagcgccgcagcagaggcctaagacgcgacgggttgcacctcttaaggatcttcctata
aatgatgagcatgtcaccgttcctccctggaaagcaaacagtcaacagcctgcatttacc
attcatgtggatgaagcagaagaagagactcagaagaggccagttgaatctaaaaaacca
gaaagtgaagatgtcttggcttttaattcagctgttactttaccaggaccgagaaaacca
ctggcacctcttgattacccaatggatggtagttttgagtcaccacatactatggatatg
tcaattgtactggaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgag
gacattcacacataccttagggaaatggaggttaaatgtaagcctaaagtgggttacatg
aagaaacagccagacattactaacagtatgagggctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggtttctttcatcgatgtctgtgttgagaggaaaacttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtatac
attacagatgacacttataccaagaaacaagttctgagaatggagcacctagttttgaaa
gtccttgcttttgacttagctgcaccaacaataaatcagtttcttacccagtactttctg
caccagcagtctgcaaactgcaaagttgaaagtttagcaatgtttttgggagaattaagt
ttgatagatgctgacccatatctaaagtatttgccatcggtgaccgccgcagcagccttt
catttagcactctacactgtcacgggacaaagctggcctgaatcattagtacaaaagact
ggatatacgctggaaactctaaagccttgtctcatggaccttcaccagacctacctcaga
gctccgcggcatgcacaacagtcaataagagaaaagtacaaaaactcaaagtatcatggt
gtttctctcctcaacccacccgagacactaaatgtgtaa

DBGET integrated database retrieval system