KEGG   Delphinapterus leucas (beluga whale): 111175264Help
Entry
111175264         CDS       T05885                                 

Gene name
HTR1F
Definition
(RefSeq) 5-hydroxytryptamine receptor 1F
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04024  cAMP signaling pathway
dle04080  Neuroactive ligand-receptor interaction
dle04726  Serotonergic synapse
dle04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    111175264 (HTR1F)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111175264 (HTR1F)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    111175264 (HTR1F)
  09157 Sensory system
   04742 Taste transduction
    111175264 (HTR1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111175264 (HTR1F)
G protein-coupled receptors [BR:dle04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    111175264 (HTR1F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 111175264
NCBI-ProteinID: XP_022430424
UniProt: A0A2Y9N6T5
LinkDB All DBs
Position
Unknown
AA seq 365 aa AA seqDB search
MDFLNSSDQNLTSEELFDRMPSKILVSFILSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVACDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGTMITIVWIISIFISMPPLFWRHQGTSREDECIIKHDNIV
STIYSTFGAFYIPLTLILILYYKIYKAAKTLYHKRQASRIAKEELNGHLLGSGEKSIRLV
STPYMLEKSLSDPSTDFDKIHSTVKSPRSEFKHERSWRRQKISGTRERKAATTLGLILGA
FVICWLPFFVKELVVNICEKCKISEEMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQKL
VRCRY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttaaactcatctgatcaaaacttgacctcggaagaactgttcgacagaatg
ccatccaaaattctggtgtccttcattctctctgggctggcactgatgacgacgaccatt
aactcacttgtgatcgctgcaattattgtgacccgaaagctacaccacccagccaactac
ttaatttgctcccttgcagtcacagattttcttgtagctgtcctggtgatgcctttcagc
attgtgtatattgtgagagagagctggattatggggcaagtggcctgtgacatttggctg
agcgttgacatcacgtgctgcacttgctccatcttgcatctctctgctatagctttggat
cggtaccgggcaatcacagatgctgttgagtatgccaggaaaaggactcccaagcatgct
ggcactatgattaccatagtttggattatatctatttttatctctatgcctcctctattc
tggaggcatcaaggaactagccgagaggatgagtgcatcatcaaacacgacaacattgtt
tccactatttactcaacatttggagctttctacatcccattaacattgattttgatcctc
tactacaaaatatataaagcagcaaagactttataccacaagagacaagcaagtaggatt
gccaaggaggagctgaatggtcaccttttggggagtggtgagaaaagcattagactggtc
tccacaccgtacatgctagaaaagtctttatctgatccatcaacggactttgataaaatt
catagcacagtgaaaagccccaggtctgaattcaagcatgagagatcctggagaaggcaa
aagatctcaggcacaagagaacgcaaagcagccactaccctgggattaatcttgggtgca
tttgtaatatgttggcttcctttttttgtaaaagaattggttgttaatatctgtgaaaag
tgtaaaatttctgaagaaatgtcaaattttttgacatggcttggatatctcaattccctt
ataaacccactgatttatacaatctttaatgaagacttcaagaaagcattccaaaaactt
gtgcgatgtcgatattag

DBGET integrated database retrieval system