KEGG   Delphinapterus leucas (beluga whale): 111175673Help
Entry
111175673         CDS       T05885                                 

Gene name
RIMKLA
Definition
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00250  Alanine, aspartate and glutamate metabolism
dle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111175673 (RIMKLA)
Enzymes [BR:dle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     111175673 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     111175673 (RIMKLA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp CPSase_L_D2 Rimk_N Synapsin_C Dala_Dala_lig_C TTL
Motif
Other DBs
NCBI-GeneID: 111175673
NCBI-ProteinID: XP_022431138
UniProt: A0A2Y9NP96
LinkDB All DBs
Position
Unknown
AA seq 391 aa AA seqDB search
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGNLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHVI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFMVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSSPREKKEPDSCASAQGVTESVYAINSGSTSSESEPELGEIRG
SSASTAGAPAPMLPDPGYNINTRIASELKLK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactaccctcaggtg
cagatcttgcgcgccctgaggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggcggcaacctcggcctgcagctgaaccag
aaggcgctcaccactttcccagacgtggtgctcgtccgggtgcccacaccctcagtgcag
tcggacagtgacatcaccgtcctgcgacacctggagaagttgggctgccgcttagtcaac
cgcccacagagcattctaaactgcatcaacaaattctggacattccaggagctggctgga
catggggtccccatgccggacaccttctcctatggtgggcatgaagacttttcaaaaatg
atcgatgaagccgagccgctgggctacccagtcgtggtgaagagcacgcgcggacaccgg
ggaaaagctgtttttctcgcaagagataaacaccacctctcagacatctgccatgtgatc
cgccacgatgtgccctacctgttccagaagtacgtgaaggagtcccacggaaaggatatc
cgggtggtggtagtaggtggccaggtgataggctctatgcttcgctgctccacagacgga
cggatgcagagcaactgctctctcggtggcgtgggcgtcatgtgcccactgacagaacaa
ggcaagcagctggctatccaggtgtccaacatcctgggcatggacttctgtggcatcgat
ctcctcatcatggacgatggctcctttatggtgtgcgaagcaaacgccaacgtgggtttc
ctagccttcgaccaggcctgcaacttagatgtgggtgggatcattgcagactacaccatg
tctttgctgcccaacaggcagaccgggaagatggctgtcctcccaggactatctagtccc
agggagaagaaagagccagacagctgtgcttcagctcagggagtcacagagagcgtctac
gccatcaacagcgggtctacctctagcgagagcgagcctgaactgggagagatccggggg
tcctcagcaagcacagcgggggccccggcccccatgctgcccgaccctggctacaacatt
aacaccaggattgcttcagaattaaaacttaagtga

DBGET integrated database retrieval system