KEGG   Delphinapterus leucas (beluga whale): 111175798
Entry
111175798         CDS       T05885                                 

Gene name
CDKN2C
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor C
  KO
K06622  cyclin-dependent kinase inhibitor 2C
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04110  Cell cycle
dle04934  Cushing syndrome
dle05166  Human T-cell leukemia virus 1 infection
dle05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111175798 (CDKN2C)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111175798 (CDKN2C)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111175798 (CDKN2C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111175798 (CDKN2C)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111175798 (CDKN2C)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3 DUF1843
Other DBs
NCBI-GeneID: 111175798
NCBI-ProteinID: XP_022431362
UniProt: A0A2Y9NPW7
LinkDB
Position
Unknown
AA seq 168 aa
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLPVVE
FLVKHTACKVGHRNHQGDTACDLARLYRRNEVVSLMEGNRAEGAANLQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa
cttactagtttgttgcaaaataatgtaaacgtcaatgcacaaaatggatttggaaggact
gcgctgcaggttatgaaacttggaaatcccgagattgccaggagactactacttagaggt
gctaatcccgatttgaaagaccgaactggtttcgctgtcattcacgatgcagccagagca
ggtttcctggacactttacagactttgctggagtttcaagctgatgttaacatcgaggat
aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccctgtggtggag
ttccttgtgaagcacacggcctgcaaagtggggcatcgaaaccatcagggggacaccgcc
tgcgacttggccaggctctaccggagaaacgaggtcgttagcctgatggagggaaaccgg
gcggagggagctgcgaatctgcaatga

DBGET integrated database retrieval system