KEGG   Delphinapterus leucas (beluga whale): 111175871
Entry
111175871         CDS       T05885                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04024  cAMP signaling pathway
dle04137  Mitophagy - animal
dle04210  Apoptosis
dle04310  Wnt signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04530  Tight junction
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04921  Oxytocin signaling pathway
dle04926  Relaxin signaling pathway
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05161  Hepatitis B
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05224  Breast cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
dle05323  Rheumatoid arthritis
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111175871 (JUN)
   04012 ErbB signaling pathway
    111175871 (JUN)
   04310 Wnt signaling pathway
    111175871 (JUN)
   04668 TNF signaling pathway
    111175871 (JUN)
   04024 cAMP signaling pathway
    111175871 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111175871 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    111175871 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111175871 (JUN)
   04530 Tight junction
    111175871 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111175871 (JUN)
   04621 NOD-like receptor signaling pathway
    111175871 (JUN)
   04625 C-type lectin receptor signaling pathway
    111175871 (JUN)
   04660 T cell receptor signaling pathway
    111175871 (JUN)
   04658 Th1 and Th2 cell differentiation
    111175871 (JUN)
   04659 Th17 cell differentiation
    111175871 (JUN)
   04657 IL-17 signaling pathway
    111175871 (JUN)
   04662 B cell receptor signaling pathway
    111175871 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111175871 (JUN)
   04915 Estrogen signaling pathway
    111175871 (JUN)
   04921 Oxytocin signaling pathway
    111175871 (JUN)
   04926 Relaxin signaling pathway
    111175871 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111175871 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111175871 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111175871 (JUN)
   05203 Viral carcinogenesis
    111175871 (JUN)
   05231 Choline metabolism in cancer
    111175871 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111175871 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111175871 (JUN)
   05211 Renal cell carcinoma
    111175871 (JUN)
   05224 Breast cancer
    111175871 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111175871 (JUN)
   05321 Inflammatory bowel disease
    111175871 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    111175871 (JUN)
   05031 Amphetamine addiction
    111175871 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111175871 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111175871 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111175871 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111175871 (JUN)
   05135 Yersinia infection
    111175871 (JUN)
   05133 Pertussis
    111175871 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111175871 (JUN)
   05170 Human immunodeficiency virus 1 infection
    111175871 (JUN)
   05161 Hepatitis B
    111175871 (JUN)
   05171 Coronavirus disease - COVID-19
    111175871 (JUN)
   05162 Measles
    111175871 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111175871 (JUN)
   05169 Epstein-Barr virus infection
    111175871 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111175871 (JUN)
   05142 Chagas disease
    111175871 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111175871 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111175871 (JUN)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    111175871 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 111175871
NCBI-ProteinID: XP_022431510
UniProt: A0A2Y9NBA9
LinkDB
Position
Unknown
AA seq 343 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGGGGGGGGGGFGASLHSEPPVYANLSNF
NPGALSGGGGGGGAPSYGAAGLAFPAQPQQQQPPPPPPPPHHLPQQIPVQHPRLQALKEE
PQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLK
AQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaagcagagcatgaccctg
aacctggccgaccccgtgggcagcctgaagccgcacctccgggccaagaactccgacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgtccc
aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccagtcagcggggcg
ggcctggtggccccggccgtggcctcggtggcgggcggcggcggtggcggcggtggcggc
ggcggcttcggcgccagcctgcacagcgagccgccggtctacgccaacctcagcaacttc
aacccgggcgcgctgagcggtggcggcggcggcggcggggcgccctcctacggcgcggcc
ggcctggcctttcccgcgcagcctcagcagcagcagccgccgccgccgccgccgccgccg
caccacctgccccagcagatccccgtgcagcacccgcggctgcaggccctgaaggaggag
ccgcagacggtccccgagatgcccggggaaacgccgcccctgtcccccatcgacatggag
tcccaggagcggatcaaggcggagaggaagcgcatgaggaaccgcatcgctgcctccaag
tgccggaaaaggaagctggagaggatcgcccgactggaggaaaaagtgaaaaccttgaaa
gcgcagaactcggagctggcgtccacggccaacatgctcagggaacaggtggcccagctt
aagcagaaagtcatgaaccacgttaacagtgggtgccaactcatgctaacgcagcagttg
caaacgttttga

DBGET integrated database retrieval system