KEGG   Delphinapterus leucas (beluga whale): 111175972Help
Entry
111175972         CDS       T05885                                 

Gene name
TCL1B
Definition
(RefSeq) T-cell leukemia/lymphoma protein 1B
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111175972 (TCL1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCL1_MTCP1
Motif
Other DBs
NCBI-GeneID: 111175972
NCBI-ProteinID: XP_022431591
UniProt: A0A2Y9NF68
LinkDB All DBs
Position
Unknown
AA seq 168 aa AA seqDB search
MEAEASPPLGSPPCCLCFRRPGIYEDENGRTWVTVALRISPSHRAWGRGSPGSTVSRSGC
GILKACPSTSGLGSPPAGPGDPGPWLCVCSSTIPDVPPPLWSLQHEIIVTVHVWQIPVHP
QMPRSPSHLLVLGLPPKWELYPGRRYQATDSRLWEIVDHGQESAWWPR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagaagcttctccgccccttgggtcgcccccatgctgcctgtgtttccggagg
cctggcatctacgaggatgagaatggaaggacctgggtgactgtggccttgcggatcagt
ccctcccacagagcttggggcaggggctcccctggcagcacagtgagtcgctctgggtgt
gggattctaaaagcatgcccatcgacctctggtctgggcagcccaccagccgggccaggg
gatccaggaccctggttgtgtgtgtgcagctcaaccatccctgatgtgccccctcctctc
tggtcccttcagcatgaaatcatcgtcacagtccacgtgtggcagataccagtgcacccc
cagatgcccaggtcccccagccatctgctcgtgctcgggctgccccccaagtgggagctc
taccccgggcgaaggtaccaagcaacggattcaagactctgggaaatagtggaccatggc
caggaaagtgcatggtggcccaggtga

DBGET integrated database retrieval system