KEGG   Delphinapterus leucas (beluga whale): 111176008
Entry
111176008         CDS       T05885                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04218  Cellular senescence
dle04261  Adrenergic signaling in cardiomyocytes
dle04370  VEGF signaling pathway
dle04371  Apelin signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04910  Insulin signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04920  Adipocytokine signaling pathway
dle04922  Glucagon signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04926  Relaxin signaling pathway
dle04929  GnRH secretion
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle04973  Carbohydrate digestion and absorption
dle05010  Alzheimer disease
dle05017  Spinocerebellar ataxia
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111176008 (AKT1)
   04012 ErbB signaling pathway
    111176008 (AKT1)
   04014 Ras signaling pathway
    111176008 (AKT1)
   04015 Rap1 signaling pathway
    111176008 (AKT1)
   04370 VEGF signaling pathway
    111176008 (AKT1)
   04371 Apelin signaling pathway
    111176008 (AKT1)
   04630 JAK-STAT signaling pathway
    111176008 (AKT1)
   04668 TNF signaling pathway
    111176008 (AKT1)
   04066 HIF-1 signaling pathway
    111176008 (AKT1)
   04068 FoxO signaling pathway
    111176008 (AKT1)
   04072 Phospholipase D signaling pathway
    111176008 (AKT1)
   04071 Sphingolipid signaling pathway
    111176008 (AKT1)
   04024 cAMP signaling pathway
    111176008 (AKT1)
   04022 cGMP-PKG signaling pathway
    111176008 (AKT1)
   04151 PI3K-Akt signaling pathway
    111176008 (AKT1)
   04152 AMPK signaling pathway
    111176008 (AKT1)
   04150 mTOR signaling pathway
    111176008 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111176008 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    111176008 (AKT1)
   04218 Cellular senescence
    111176008 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111176008 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    111176008 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111176008 (AKT1)
   04613 Neutrophil extracellular trap formation
    111176008 (AKT1)
   04620 Toll-like receptor signaling pathway
    111176008 (AKT1)
   04625 C-type lectin receptor signaling pathway
    111176008 (AKT1)
   04660 T cell receptor signaling pathway
    111176008 (AKT1)
   04662 B cell receptor signaling pathway
    111176008 (AKT1)
   04664 Fc epsilon RI signaling pathway
    111176008 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    111176008 (AKT1)
   04062 Chemokine signaling pathway
    111176008 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111176008 (AKT1)
   04922 Glucagon signaling pathway
    111176008 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    111176008 (AKT1)
   04920 Adipocytokine signaling pathway
    111176008 (AKT1)
   04929 GnRH secretion
    111176008 (AKT1)
   04915 Estrogen signaling pathway
    111176008 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    111176008 (AKT1)
   04917 Prolactin signaling pathway
    111176008 (AKT1)
   04926 Relaxin signaling pathway
    111176008 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    111176008 (AKT1)
   04919 Thyroid hormone signaling pathway
    111176008 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111176008 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111176008 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    111176008 (AKT1)
   04728 Dopaminergic synapse
    111176008 (AKT1)
   04722 Neurotrophin signaling pathway
    111176008 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111176008 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    111176008 (AKT1)
   04213 Longevity regulating pathway - multiple species
    111176008 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111176008 (AKT1)
   05205 Proteoglycans in cancer
    111176008 (AKT1)
   05230 Central carbon metabolism in cancer
    111176008 (AKT1)
   05231 Choline metabolism in cancer
    111176008 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111176008 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111176008 (AKT1)
   05212 Pancreatic cancer
    111176008 (AKT1)
   05225 Hepatocellular carcinoma
    111176008 (AKT1)
   05226 Gastric cancer
    111176008 (AKT1)
   05214 Glioma
    111176008 (AKT1)
   05221 Acute myeloid leukemia
    111176008 (AKT1)
   05220 Chronic myeloid leukemia
    111176008 (AKT1)
   05218 Melanoma
    111176008 (AKT1)
   05211 Renal cell carcinoma
    111176008 (AKT1)
   05215 Prostate cancer
    111176008 (AKT1)
   05213 Endometrial cancer
    111176008 (AKT1)
   05224 Breast cancer
    111176008 (AKT1)
   05222 Small cell lung cancer
    111176008 (AKT1)
   05223 Non-small cell lung cancer
    111176008 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111176008 (AKT1)
   05017 Spinocerebellar ataxia
    111176008 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111176008 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111176008 (AKT1)
   04931 Insulin resistance
    111176008 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111176008 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111176008 (AKT1)
   05135 Yersinia infection
    111176008 (AKT1)
   05152 Tuberculosis
    111176008 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111176008 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    111176008 (AKT1)
   05161 Hepatitis B
    111176008 (AKT1)
   05160 Hepatitis C
    111176008 (AKT1)
   05164 Influenza A
    111176008 (AKT1)
   05162 Measles
    111176008 (AKT1)
   05168 Herpes simplex virus 1 infection
    111176008 (AKT1)
   05163 Human cytomegalovirus infection
    111176008 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111176008 (AKT1)
   05169 Epstein-Barr virus infection
    111176008 (AKT1)
   05165 Human papillomavirus infection
    111176008 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111176008 (AKT1)
   05142 Chagas disease
    111176008 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111176008 (AKT1)
   01524 Platinum drug resistance
    111176008 (AKT1)
   01522 Endocrine resistance
    111176008 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111176008 (AKT1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111176008 (AKT1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111176008 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 111176008
NCBI-ProteinID: XP_022431645
UniProt: A0A2Y9NBQ2
LinkDB
Position
Unknown
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEDEMMDF
RSGSPGENSGAEEMEVALAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQIITITPPDRDDSMEGVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggctggctgcacaaacgaggtgagtacatcaaa
acctggcggccccggtacttcctcttgaagaacgacggcaccttcatcggctacaaggag
cggccgcaggacgtggagcagcgcgagtcgcccctgaacaacttctccgtggcgcagtgc
cagctgatgaagacggagcggccgcggcccaacacctttatcatccgctgcctgcagtgg
accacggtcatcgagcgcacgttccacgtggagaccccggaggagcgggaggagtggaca
accgccatccagacggtggccgacgggctcaagaggcaggaggacgagatgatggacttc
cggtcgggctcgcctggcgagaactcgggggccgaggagatggaggtggcgctggccaag
cccaagcaccgcgtgaccatgaatgagtttgagtacctgaagctgctgggcaaaggcacc
ttcgggaaggtgatcctggtgaaggagaaggccacgggccgctactatgccatgaagatc
ctgaagaaggaggtcattgtggccaaggacgaggtggcccacacgctcacggagaaccgc
gtcctccagaactcccggcaccctttcctgacggccctgaagtactccttccagacccac
gaccgcctgtgcttcgtcatggagtacgccaacggaggcgagctcttcttccacctgtcc
cgggagcgggtgttccccgaggaccgggcccggttctacggcgccgagatcgtgtctgcc
ctggactacctgcactcagagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcacggacttcgggctgtgcaaggagggcatc
aaggatggcgccaccatgaagaccttctgcgggacgcctgagtacctggcccccgaggtg
ctggaggacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagcttttcgagctc
atcctcatggaggagatccgcttcccacgcacgctcagccctgaggccaagtccctgctc
tcagggctgctcaagaaggaccccaagcagcggctcggtgggggctccgaggacgccaag
gagatcatgcagcaccgcttcttcgccagcatcgtgtggcaggatgtgtatgagaagaag
ctcagcccacccttcaagcctcaggtcacgtccgagacggacaccaggtattttgacgaa
gagttcacagcccagattatcaccatcacgccgcccgaccgagacgacagcatggagggc
gtggacagcgagcggaggcctcacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Delphinapterus leucas (beluga whale): 111177559
Entry
111177559         CDS       T05885                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04218  Cellular senescence
dle04261  Adrenergic signaling in cardiomyocytes
dle04370  VEGF signaling pathway
dle04371  Apelin signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04910  Insulin signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04920  Adipocytokine signaling pathway
dle04922  Glucagon signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04926  Relaxin signaling pathway
dle04929  GnRH secretion
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle04973  Carbohydrate digestion and absorption
dle05010  Alzheimer disease
dle05017  Spinocerebellar ataxia
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111177559 (AKT3)
   04012 ErbB signaling pathway
    111177559 (AKT3)
   04014 Ras signaling pathway
    111177559 (AKT3)
   04015 Rap1 signaling pathway
    111177559 (AKT3)
   04370 VEGF signaling pathway
    111177559 (AKT3)
   04371 Apelin signaling pathway
    111177559 (AKT3)
   04630 JAK-STAT signaling pathway
    111177559 (AKT3)
   04668 TNF signaling pathway
    111177559 (AKT3)
   04066 HIF-1 signaling pathway
    111177559 (AKT3)
   04068 FoxO signaling pathway
    111177559 (AKT3)
   04072 Phospholipase D signaling pathway
    111177559 (AKT3)
   04071 Sphingolipid signaling pathway
    111177559 (AKT3)
   04024 cAMP signaling pathway
    111177559 (AKT3)
   04022 cGMP-PKG signaling pathway
    111177559 (AKT3)
   04151 PI3K-Akt signaling pathway
    111177559 (AKT3)
   04152 AMPK signaling pathway
    111177559 (AKT3)
   04150 mTOR signaling pathway
    111177559 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111177559 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    111177559 (AKT3)
   04218 Cellular senescence
    111177559 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111177559 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    111177559 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111177559 (AKT3)
   04613 Neutrophil extracellular trap formation
    111177559 (AKT3)
   04620 Toll-like receptor signaling pathway
    111177559 (AKT3)
   04625 C-type lectin receptor signaling pathway
    111177559 (AKT3)
   04660 T cell receptor signaling pathway
    111177559 (AKT3)
   04662 B cell receptor signaling pathway
    111177559 (AKT3)
   04664 Fc epsilon RI signaling pathway
    111177559 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    111177559 (AKT3)
   04062 Chemokine signaling pathway
    111177559 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111177559 (AKT3)
   04922 Glucagon signaling pathway
    111177559 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    111177559 (AKT3)
   04920 Adipocytokine signaling pathway
    111177559 (AKT3)
   04929 GnRH secretion
    111177559 (AKT3)
   04915 Estrogen signaling pathway
    111177559 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    111177559 (AKT3)
   04917 Prolactin signaling pathway
    111177559 (AKT3)
   04926 Relaxin signaling pathway
    111177559 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    111177559 (AKT3)
   04919 Thyroid hormone signaling pathway
    111177559 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111177559 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111177559 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    111177559 (AKT3)
   04728 Dopaminergic synapse
    111177559 (AKT3)
   04722 Neurotrophin signaling pathway
    111177559 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111177559 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    111177559 (AKT3)
   04213 Longevity regulating pathway - multiple species
    111177559 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177559 (AKT3)
   05205 Proteoglycans in cancer
    111177559 (AKT3)
   05230 Central carbon metabolism in cancer
    111177559 (AKT3)
   05231 Choline metabolism in cancer
    111177559 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111177559 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111177559 (AKT3)
   05212 Pancreatic cancer
    111177559 (AKT3)
   05225 Hepatocellular carcinoma
    111177559 (AKT3)
   05226 Gastric cancer
    111177559 (AKT3)
   05214 Glioma
    111177559 (AKT3)
   05221 Acute myeloid leukemia
    111177559 (AKT3)
   05220 Chronic myeloid leukemia
    111177559 (AKT3)
   05218 Melanoma
    111177559 (AKT3)
   05211 Renal cell carcinoma
    111177559 (AKT3)
   05215 Prostate cancer
    111177559 (AKT3)
   05213 Endometrial cancer
    111177559 (AKT3)
   05224 Breast cancer
    111177559 (AKT3)
   05222 Small cell lung cancer
    111177559 (AKT3)
   05223 Non-small cell lung cancer
    111177559 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111177559 (AKT3)
   05017 Spinocerebellar ataxia
    111177559 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111177559 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111177559 (AKT3)
   04931 Insulin resistance
    111177559 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111177559 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111177559 (AKT3)
   05135 Yersinia infection
    111177559 (AKT3)
   05152 Tuberculosis
    111177559 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111177559 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    111177559 (AKT3)
   05161 Hepatitis B
    111177559 (AKT3)
   05160 Hepatitis C
    111177559 (AKT3)
   05164 Influenza A
    111177559 (AKT3)
   05162 Measles
    111177559 (AKT3)
   05168 Herpes simplex virus 1 infection
    111177559 (AKT3)
   05163 Human cytomegalovirus infection
    111177559 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111177559 (AKT3)
   05169 Epstein-Barr virus infection
    111177559 (AKT3)
   05165 Human papillomavirus infection
    111177559 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111177559 (AKT3)
   05142 Chagas disease
    111177559 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111177559 (AKT3)
   01524 Platinum drug resistance
    111177559 (AKT3)
   01522 Endocrine resistance
    111177559 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111177559 (AKT3)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111177559 (AKT3)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111177559 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2
Other DBs
NCBI-GeneID: 111177559
NCBI-ProteinID: XP_022435149
UniProt: A0A2Y9NJE3
LinkDB
Position
Unknown
AA seq 541 aa
MSDVTIVKEGWVQKRAPKRLSIGRHQILRKVEVRSGAENGDWSENSSRSILCGEKLLYYS
HDTVLQSLDQRAEQETMGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAK
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMN
CSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKI
LKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLS
RERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGIT
DAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELI
LMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKL
VPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCTDSERRPHFPQFSYSASGR
E
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagagggctcccaagaggctc
agcattgggaggcaccagatactaaggaaagttgaggtcagaagtggagctgaaaacgga
gattggtcagaaaatagtagcaggagtattttgtgtggtgaaaagttgctgtactactct
catgacactgttctccaaagcctggatcaaagggcagaacaggagactatgggagaatat
ataaaaaactggaggccaagatatttccttttgaagacagatggctcattcataggatat
aaagagaaaccccaagatgtggatttaccttatcccctcaacaacttttcagtagcaaaa
tgccagttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccag
tggaccactgttatagagagaacatttcatgtagacactccagaggaaagggaagaatgg
acagaagctatccaggctgtagcagacagactccagaggcaagaagaggagagaatgaat
tgtagtccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacc
catcataaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcact
tttgggaaagttattttggttcgagagaaagcaagtggaaaatactatgctatgaagatt
ctgaagaaggaagttattattgccaaggatgaagtggcacacactttaactgaaagcaga
gtattaaagaacactagacatccctttttaacatccttgaaatattccttccagacaaaa
gaccgtttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcg
agagagagggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgct
ttggactatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatg
ctggataaagatggccacataaaaattacagattttggactttgcaaagaagggatcaca
gatgcagccaccatgaagacgttctgtggtacaccagaatatctggcaccagaggtgtta
gaagataatgactatggccgagccgtggattggtggggccttggggttgtcatgtatgaa
atgatgtgcgggaggttacctttctacaaccaggatcatgagaaactttttgaactaatt
ctaatggaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttca
gggctcttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaa
attatgagacacagtttcttttctggagtaaactggcaagatgtgtatgataaaaagctt
gtacctccttttaagcctcaagtaacatctgagacagacaccagatactttgatgaagaa
tttacagctcagactattacaataacaccacctgaaaagtacgatgaggacggtatggac
tgcacggacagtgagaggcggccgcacttccctcagttttcctactctgcaagcggacga
gaataa

KEGG   Delphinapterus leucas (beluga whale): 111180855
Entry
111180855         CDS       T05885                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04218  Cellular senescence
dle04261  Adrenergic signaling in cardiomyocytes
dle04370  VEGF signaling pathway
dle04371  Apelin signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04910  Insulin signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04920  Adipocytokine signaling pathway
dle04922  Glucagon signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04926  Relaxin signaling pathway
dle04929  GnRH secretion
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle04973  Carbohydrate digestion and absorption
dle05010  Alzheimer disease
dle05017  Spinocerebellar ataxia
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111180855 (AKT2)
   04012 ErbB signaling pathway
    111180855 (AKT2)
   04014 Ras signaling pathway
    111180855 (AKT2)
   04015 Rap1 signaling pathway
    111180855 (AKT2)
   04370 VEGF signaling pathway
    111180855 (AKT2)
   04371 Apelin signaling pathway
    111180855 (AKT2)
   04630 JAK-STAT signaling pathway
    111180855 (AKT2)
   04668 TNF signaling pathway
    111180855 (AKT2)
   04066 HIF-1 signaling pathway
    111180855 (AKT2)
   04068 FoxO signaling pathway
    111180855 (AKT2)
   04072 Phospholipase D signaling pathway
    111180855 (AKT2)
   04071 Sphingolipid signaling pathway
    111180855 (AKT2)
   04024 cAMP signaling pathway
    111180855 (AKT2)
   04022 cGMP-PKG signaling pathway
    111180855 (AKT2)
   04151 PI3K-Akt signaling pathway
    111180855 (AKT2)
   04152 AMPK signaling pathway
    111180855 (AKT2)
   04150 mTOR signaling pathway
    111180855 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111180855 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    111180855 (AKT2)
   04218 Cellular senescence
    111180855 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111180855 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    111180855 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111180855 (AKT2)
   04613 Neutrophil extracellular trap formation
    111180855 (AKT2)
   04620 Toll-like receptor signaling pathway
    111180855 (AKT2)
   04625 C-type lectin receptor signaling pathway
    111180855 (AKT2)
   04660 T cell receptor signaling pathway
    111180855 (AKT2)
   04662 B cell receptor signaling pathway
    111180855 (AKT2)
   04664 Fc epsilon RI signaling pathway
    111180855 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    111180855 (AKT2)
   04062 Chemokine signaling pathway
    111180855 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111180855 (AKT2)
   04922 Glucagon signaling pathway
    111180855 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    111180855 (AKT2)
   04920 Adipocytokine signaling pathway
    111180855 (AKT2)
   04929 GnRH secretion
    111180855 (AKT2)
   04915 Estrogen signaling pathway
    111180855 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    111180855 (AKT2)
   04917 Prolactin signaling pathway
    111180855 (AKT2)
   04926 Relaxin signaling pathway
    111180855 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    111180855 (AKT2)
   04919 Thyroid hormone signaling pathway
    111180855 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111180855 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111180855 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    111180855 (AKT2)
   04728 Dopaminergic synapse
    111180855 (AKT2)
   04722 Neurotrophin signaling pathway
    111180855 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111180855 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    111180855 (AKT2)
   04213 Longevity regulating pathway - multiple species
    111180855 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180855 (AKT2)
   05205 Proteoglycans in cancer
    111180855 (AKT2)
   05230 Central carbon metabolism in cancer
    111180855 (AKT2)
   05231 Choline metabolism in cancer
    111180855 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111180855 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111180855 (AKT2)
   05212 Pancreatic cancer
    111180855 (AKT2)
   05225 Hepatocellular carcinoma
    111180855 (AKT2)
   05226 Gastric cancer
    111180855 (AKT2)
   05214 Glioma
    111180855 (AKT2)
   05221 Acute myeloid leukemia
    111180855 (AKT2)
   05220 Chronic myeloid leukemia
    111180855 (AKT2)
   05218 Melanoma
    111180855 (AKT2)
   05211 Renal cell carcinoma
    111180855 (AKT2)
   05215 Prostate cancer
    111180855 (AKT2)
   05213 Endometrial cancer
    111180855 (AKT2)
   05224 Breast cancer
    111180855 (AKT2)
   05222 Small cell lung cancer
    111180855 (AKT2)
   05223 Non-small cell lung cancer
    111180855 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111180855 (AKT2)
   05017 Spinocerebellar ataxia
    111180855 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111180855 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111180855 (AKT2)
   04931 Insulin resistance
    111180855 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111180855 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111180855 (AKT2)
   05135 Yersinia infection
    111180855 (AKT2)
   05152 Tuberculosis
    111180855 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111180855 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    111180855 (AKT2)
   05161 Hepatitis B
    111180855 (AKT2)
   05160 Hepatitis C
    111180855 (AKT2)
   05164 Influenza A
    111180855 (AKT2)
   05162 Measles
    111180855 (AKT2)
   05168 Herpes simplex virus 1 infection
    111180855 (AKT2)
   05163 Human cytomegalovirus infection
    111180855 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111180855 (AKT2)
   05169 Epstein-Barr virus infection
    111180855 (AKT2)
   05165 Human papillomavirus infection
    111180855 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111180855 (AKT2)
   05142 Chagas disease
    111180855 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111180855 (AKT2)
   01524 Platinum drug resistance
    111180855 (AKT2)
   01522 Endocrine resistance
    111180855 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111180855 (AKT2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111180855 (AKT2)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111180855 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7
Other DBs
NCBI-GeneID: 111180855
NCBI-ProteinID: XP_022441352
UniProt: A0A2Y9PDM4
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVVKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMQAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
VSDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDATEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcgtcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggcggccccggtacttcctgctgaagagcgacggctccttcattggatataaggag
cggcccgaggcccccgaccagaccctgccccccttaaacaacttctctgttgcagaatgc
cagctgatgaagaccgagagaccgcggcccaacaccttcgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccatgtagactctccggatgagagggaggagtggatg
caggccatccaaatggttgccaacagcctcaagcagcggggcccaggtgaggaccccatg
gactacaagtgtggctcccccagcgactcttctgcagccgaggagatggaagtggcagtt
agcaaggcgcgggccaaggtgaccatgaatgacttcgactatctcaagctcctgggcaag
ggcacctttggcaaagtcatcctggtgcgggagaaggccagtggccgctactacgccatg
aagatcttgcggaaggaggttatcatcgctaaggatgaagtcgcccacacggtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaacggtggcgagctgttcttccac
ctgtcccgggaacgcgtcttcacggaggagcgggcccgcttttatggtgcggagatcgtc
tcagccctggagtacctgcactcgcgggacgtggtgtaccgtgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgacttcggcctgtgcaaagagggc
gtcagtgatggggccaccatgaaaaccttctgtgggacccctgaatacctggcgcccgag
gtgctggaggacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccctgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagtgatgcc
acggaggtcatggagcacaggttcttcctcagtatcaactggcaggacgtggtgcagaag
aagctcctgccacccttcaaacctcaggtcacatctgaggttgacacaaggtactttgac
gacgagttcaccgcccagtccatcacaatcacacccccggaccgctatgacagcctgggc
ttactcgaactggaccagcggacccacttcccccagttctcctattcggccagcatccgg
gagtga

DBGET integrated database retrieval system