KEGG   Delphinapterus leucas (beluga whale): 111176049
Entry
111176049         CDS       T05885                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3 isoform X1
  KO
K03174  TNF receptor-associated factor 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04064  NF-kappa B signaling pathway
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04668  TNF signaling pathway
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111176049 (TRAF3)
   04668 TNF signaling pathway
    111176049 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111176049 (TRAF3)
   04621 NOD-like receptor signaling pathway
    111176049 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    111176049 (TRAF3)
   04657 IL-17 signaling pathway
    111176049 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111176049 (TRAF3)
   05203 Viral carcinogenesis
    111176049 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111176049 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111176049 (TRAF3)
   05160 Hepatitis C
    111176049 (TRAF3)
   05171 Coronavirus disease - COVID-19
    111176049 (TRAF3)
   05164 Influenza A
    111176049 (TRAF3)
   05162 Measles
    111176049 (TRAF3)
   05168 Herpes simplex virus 1 infection
    111176049 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111176049 (TRAF3)
   05169 Epstein-Barr virus infection
    111176049 (TRAF3)
   05165 Human papillomavirus infection
    111176049 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Spc7 MPS2 Spc29 zf-C3HC4_2 zf-RING_4 Cast Tropomyosin_1 Sina zf-RING_5 KxDL Crescentin GAS Fib_alpha ADIP LMBR1 FliJ DUF3450 DUF1664 SPATA24
Other DBs
NCBI-GeneID: 111176049
NCBI-ProteinID: XP_022431739
UniProt: A0A2Y9NC44
LinkDB
Position
Unknown
AA seq 572 aa
MTHRMEPSKKLDAAGTLPANPPLKLHPDRGAGPAVLVPEQGGYKERFVKAVEDKYKCEKC
RLVLCNPKQTECGHRFCETCMGALLSSSSPKCTACREGISKDKVFKDNCCKREILALQIY
CRNEGRGCAEQLALGHLLVHLKNDCQFEELLCVRADCKEKVLRKDLRDHVDKACKYREAT
CGHCRSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKR
YGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQIC
SFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQSWEEAGSMKSSVES
LQSRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNG
VLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFV
IMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPV
FVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgacacacaggatggagccgagtaaaaagctggacgcagccggcaccctgccagccaac
cccccactgaagctgcaccccgaccgcggcgccgggcctgccgtcctggtccccgagcag
gggggctacaaggagcgcttcgtgaaggccgtggaggacaagtacaagtgtgagaagtgc
cgcctggtgctctgcaaccccaagcagaccgagtgcggacaccgcttctgcgagacctgc
atgggcgccctgctcagctcctccagcccgaaatgcactgcgtgtcgagaaggcatcagc
aaagacaaggtgtttaaggataattgctgcaagagagagattctggcccttcagatatac
tgtaggaacgaaggcagaggctgtgcagagcagttagcactggggcacctgctggtgcat
ttgaagaatgattgccagtttgaggaacttttgtgtgtccgtgccgactgcaaagagaag
gtgctgaggaaggacctgcgtgaccacgtggacaaggcctgtaaataccgtgaggccacg
tgcggccactgcagaagccaggtcccgatgataacgctgcagaaacacgaagacaccgag
tgtccctgcgtggtggtgtcctgccctcataagtgcagtgtccagacccttctgaggagc
gagttgagtgcacacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgc
tatggctgcgtttttcaggggacaaaccagcagattaaggcccacgaggccagctccgcg
gtgcagcatgtcaacttactcaaagaatggagcaactctctagagaaaaaggtttccttg
ctgcagaatgaaagcgtagaaaaaaacaagagcatacagagtttgcacaaccagatatgc
agctttgaaattgaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaata
cttcatttacagcgagtaatagacagccaagcagagaaactgaaggagctcgacaaggag
atccgccccttccggcagagctgggaggaggcaggcagcatgaagagcagcgtggagtcg
ctccagagccgggtgaccgagctggagagtgtggacaagagtgcggggcaggcggctcgg
aacacaggcctgctggagtcccagctgagccggcacgaccagatgctgagtgtccacgac
atccgcctggccgacatggacctgcggttccaggtcctggagaccgccagctacaacggt
gtgctgatctggaagatccgggattacaagcggcggaagcaggaggccgtcatggggaag
accctgtccctctacagccagcctttctacaccggctatttcggctacaagatgtgcgcc
agggtctacctgaacggggatggcatgggcaaggggacgcacctgtcgctgttcttcgtc
atcatgcgcggagaatacgacgccctccttccctggccgttcaagcagaaggtgacgctc
atgctgatggaccaggggtcctcccggcgacacttgggggacgctttcaagccggacccc
aacagcagcagcttcaagaagcccaccggcgagatgaacatcgcttccggctgcccagtc
ttcgtggcgcagactgtgctggaaaacgggacgtacattaaagatgataccatttttatc
aaagtcatagtggatacttcggacctgccagacccctga

DBGET integrated database retrieval system