KEGG   Delphinapterus leucas (beluga whale): 111176049
Entry
111176049         CDS       T05885                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3 isoform X1
  KO
K03174  TNF receptor-associated factor 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04064  NF-kappa B signaling pathway
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04668  TNF signaling pathway
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111176049 (TRAF3)
   04668 TNF signaling pathway
    111176049 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111176049 (TRAF3)
   04621 NOD-like receptor signaling pathway
    111176049 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    111176049 (TRAF3)
   04657 IL-17 signaling pathway
    111176049 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111176049 (TRAF3)
   05203 Viral carcinogenesis
    111176049 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111176049 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111176049 (TRAF3)
   05160 Hepatitis C
    111176049 (TRAF3)
   05171 Coronavirus disease - COVID-19
    111176049 (TRAF3)
   05164 Influenza A
    111176049 (TRAF3)
   05162 Measles
    111176049 (TRAF3)
   05168 Herpes simplex virus 1 infection
    111176049 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111176049 (TRAF3)
   05169 Epstein-Barr virus infection
    111176049 (TRAF3)
   05165 Human papillomavirus infection
    111176049 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Spc7 MPS2 Spc29 zf-C3HC4_2 zf-RING_4 Cast Tropomyosin_1 Sina zf-RING_5 KxDL Crescentin GAS Fib_alpha ADIP LMBR1 FliJ DUF3450 DUF1664 SPATA24
Other DBs
NCBI-GeneID: 111176049
NCBI-ProteinID: XP_022431739
UniProt: A0A2Y9NC44
LinkDB
Position
Unknown
AA seq 572 aa
MTHRMEPSKKLDAAGTLPANPPLKLHPDRGAGPAVLVPEQGGYKERFVKAVEDKYKCEKC
RLVLCNPKQTECGHRFCETCMGALLSSSSPKCTACREGISKDKVFKDNCCKREILALQIY
CRNEGRGCAEQLALGHLLVHLKNDCQFEELLCVRADCKEKVLRKDLRDHVDKACKYREAT
CGHCRSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKR
YGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQIC
SFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQSWEEAGSMKSSVES
LQSRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNG
VLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFV
IMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPV
FVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgacacacaggatggagccgagtaaaaagctggacgcagccggcaccctgccagccaac
cccccactgaagctgcaccccgaccgcggcgccgggcctgccgtcctggtccccgagcag
gggggctacaaggagcgcttcgtgaaggccgtggaggacaagtacaagtgtgagaagtgc
cgcctggtgctctgcaaccccaagcagaccgagtgcggacaccgcttctgcgagacctgc
atgggcgccctgctcagctcctccagcccgaaatgcactgcgtgtcgagaaggcatcagc
aaagacaaggtgtttaaggataattgctgcaagagagagattctggcccttcagatatac
tgtaggaacgaaggcagaggctgtgcagagcagttagcactggggcacctgctggtgcat
ttgaagaatgattgccagtttgaggaacttttgtgtgtccgtgccgactgcaaagagaag
gtgctgaggaaggacctgcgtgaccacgtggacaaggcctgtaaataccgtgaggccacg
tgcggccactgcagaagccaggtcccgatgataacgctgcagaaacacgaagacaccgag
tgtccctgcgtggtggtgtcctgccctcataagtgcagtgtccagacccttctgaggagc
gagttgagtgcacacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgc
tatggctgcgtttttcaggggacaaaccagcagattaaggcccacgaggccagctccgcg
gtgcagcatgtcaacttactcaaagaatggagcaactctctagagaaaaaggtttccttg
ctgcagaatgaaagcgtagaaaaaaacaagagcatacagagtttgcacaaccagatatgc
agctttgaaattgaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaata
cttcatttacagcgagtaatagacagccaagcagagaaactgaaggagctcgacaaggag
atccgccccttccggcagagctgggaggaggcaggcagcatgaagagcagcgtggagtcg
ctccagagccgggtgaccgagctggagagtgtggacaagagtgcggggcaggcggctcgg
aacacaggcctgctggagtcccagctgagccggcacgaccagatgctgagtgtccacgac
atccgcctggccgacatggacctgcggttccaggtcctggagaccgccagctacaacggt
gtgctgatctggaagatccgggattacaagcggcggaagcaggaggccgtcatggggaag
accctgtccctctacagccagcctttctacaccggctatttcggctacaagatgtgcgcc
agggtctacctgaacggggatggcatgggcaaggggacgcacctgtcgctgttcttcgtc
atcatgcgcggagaatacgacgccctccttccctggccgttcaagcagaaggtgacgctc
atgctgatggaccaggggtcctcccggcgacacttgggggacgctttcaagccggacccc
aacagcagcagcttcaagaagcccaccggcgagatgaacatcgcttccggctgcccagtc
ttcgtggcgcagactgtgctggaaaacgggacgtacattaaagatgataccatttttatc
aaagtcatagtggatacttcggacctgccagacccctga

KEGG   Delphinapterus leucas (beluga whale): 111177009
Entry
111177009         CDS       T05885                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04064  NF-kappa B signaling pathway
dle04071  Sphingolipid signaling pathway
dle04141  Protein processing in endoplasmic reticulum
dle04210  Apoptosis
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04668  TNF signaling pathway
dle04920  Adipocytokine signaling pathway
dle04932  Non-alcoholic fatty liver disease
dle05010  Alzheimer disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05160  Hepatitis C
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111177009 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111177009 (TRAF2)
   04064 NF-kappa B signaling pathway
    111177009 (TRAF2)
   04668 TNF signaling pathway
    111177009 (TRAF2)
   04071 Sphingolipid signaling pathway
    111177009 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111177009 (TRAF2)
   04217 Necroptosis
    111177009 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111177009 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    111177009 (TRAF2)
   04657 IL-17 signaling pathway
    111177009 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111177009 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111177009 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177009 (TRAF2)
   05203 Viral carcinogenesis
    111177009 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111177009 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111177009 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    111177009 (TRAF2)
   05016 Huntington disease
    111177009 (TRAF2)
   05017 Spinocerebellar ataxia
    111177009 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    111177009 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111177009 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111177009 (TRAF2)
   05135 Yersinia infection
    111177009 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111177009 (TRAF2)
   05160 Hepatitis C
    111177009 (TRAF2)
   05168 Herpes simplex virus 1 infection
    111177009 (TRAF2)
   05163 Human cytomegalovirus infection
    111177009 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111177009 (TRAF2)
   05169 Epstein-Barr virus infection
    111177009 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111177009 (TRAF2)
   04121 Ubiquitin system [BR:dle04121]
    111177009 (TRAF2)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111177009 (TRAF2)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     111177009 (TRAF2)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    111177009 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_6 zf-C3HC4_2 zf-C3HC4_4
Other DBs
NCBI-GeneID: 111177009
NCBI-ProteinID: XP_022433841
UniProt: A0A2Y9NLV0
LinkDB
Position
Unknown
AA seq 516 aa
MAAASATPPGSLDLLQPGFSKTLLGTKLEDKYLCSACRNVLRRPFQAQCGHRYCSFCLSS
ILSSGPQNCAACVNEGIYEEGVSILESSSAFPDNAARREVESLPAVCSSEGCTWKGTLKE
YESGHEGHCPFVLTECPACKGLVRLGEKEHHLEHACPERSLSCRHCRVPCCSADMKAHHQ
VCPKFPLTCEGCGKKKITREKFQDHVRTCGRCRVPCRFHAVGCPEMVEGEKLQEHEAQRL
REHLALLLGALLEAGPPLLSQGEQGWGASTPGPAAAPSQAAELLQRCEALERKTATFENI
VCVLNREVERVAVTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMADLEQKVHEM
EASTFDGVFIWKIPDFARKRQEAVSGRTPAIFSPAFYTSRYGYKMCLRAYLNGDGTGRGT
HLSLFFVLMKGPHDALLHWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNI
ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggctgcagccagcgcgacccctcccggctccctggacctgctgcagcctggcttctcc
aagaccctcctggggaccaagctagaggacaagtacctgtgctcggcctgcaggaacgtc
ctgcgcaggcccttccaggctcagtgtggccaccgctattgttccttctgcctgagcagc
atcctgagctccgggccccagaactgtgccgcctgcgtgaacgagggcatttacgaggaa
ggcgtctctatcctggagagcagctcggctttcccggacaatgctgcccgcagggaggta
gagagcctgccggccgtctgttccagcgagggctgcacctggaaggggaccctgaaggag
tacgagagtggccacgaaggacactgcccgttcgtgctgaccgagtgcccggcgtgtaaa
ggcctggtgcgcctgggcgagaaggaacaccacctggagcacgcgtgcccggagcgaagc
ctcagctgccggcactgcagggtgccctgctgctcggccgacatgaaggcgcaccaccag
gtctgccccaagttccccttgacctgcgagggctgcggcaagaagaagatcacacgcgag
aaatttcaggaccacgtcaggacatgtggcagatgccgagtcccctgcaggttccacgct
gtcggctgccccgagatggtggagggcgagaagctgcaggagcacgaggcgcagcggctc
cgggagcacctggccctgcttctgggcgccctcctggaggccgggccccccctcctcagc
cagggcgagcagggctggggggccagcacgccaggcccggcggcagcgccctcccaggcg
gcggagctgctgcagaggtgcgaggccctggagcggaagacggccaccttcgagaacatc
gtctgcgtgctgaaccgggaggtggagcgggtggctgtgactgccgaggcctgcggccgg
cagcaccggctggaccaagacaggatcgaagccctgagtaataaggtgcagcagctggag
aggagcatcggcctgaaggacctggccatggctgacctggagcagaaggtccacgagatg
gaggcgtccaccttcgacggggtgttcatctggaagatcccggacttcgccaggaagcgc
caggaagccgtgtctggccgcacacccgccatcttctccccagccttctacaccagcaga
tacggctacaagatgtgtctgcgcgcctacctgaacggagatggcaccgggcgcgggacg
cacctgtccctcttcttcgttctgatgaagggcccccacgacgccctcctgcactggccc
ttcaaccagaaggtgaccctgatgttgctggaccagaacaaccgggagcatgtgattgac
gccttcaggcccgacgtgacctcatcctcgttccagaggccggtcagcgacatgaacatc
gcgagcggctgcccgcttttctgccctgtctccaagatggaggccaagaattcctacgtg
cgtgacgacgccatcttcatcaaggccatagtggacctgacagggctctag

KEGG   Delphinapterus leucas (beluga whale): 111177267
Entry
111177267         CDS       T05885                                 

Gene name
TRAF1
Definition
(RefSeq) TNF receptor-associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04064  NF-kappa B signaling pathway
dle04210  Apoptosis
dle04668  TNF signaling pathway
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111177267 (TRAF1)
   04668 TNF signaling pathway
    111177267 (TRAF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111177267 (TRAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177267 (TRAF1)
   05202 Transcriptional misregulation in cancer
    111177267 (TRAF1)
   05203 Viral carcinogenesis
    111177267 (TRAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111177267 (TRAF1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd
Other DBs
NCBI-GeneID: 111177267
NCBI-ProteinID: XP_022434586
UniProt: A0A2Y9NTP2
LinkDB
Position
Unknown
AA seq 415 aa
MASGSASSRHPAPDENEFPFGCPPTVCQDPPEPRPLCCSVCLSENVRNGEDRICPKCKGD
DTPSERPGSLLSQEQDHSEVAEAGVGCPFAGVGCAFKGGPKFMQEHEVTSQATHLNLLLG
FMKQWKTQLGSGLGSGPMALERNLSDLQLQGAVEAAGDLEVDCYRAPCSESQEELALQHF
MKEKLLTELEGKLCVFENIVAVLNKEVEASHLALAASIHQSRLGREHILSLERRVMELQQ
TLAQKDQALVKLEQSFRLMEEASYDGTFLWKVTSVTRRCHESACGRTVSLFSPAFYTAKY
GYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA
FRPDLNSASFQRPQSETNVASGCPLFFPLNKLQSPKHAYVKDDTMFLKCIVETDA
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcctctggctcggccagcagccgccaccccgcccccgatgagaacgagttccccttt
gggtgcccccccaccgtctgccaggacccaccagagcccaggcccctctgctgctccgtc
tgtctctctgagaacgtgaggaatggtgaggatcggatctgtcccaaatgcaaaggggac
gacacaccatctgagaggccaggaagccttctgtctcaggagcaggatcactccgaggtg
gctgaggctggagttgggtgtccctttgcaggtgttggctgcgccttcaaggggggccca
aagttcatgcaggagcatgaggtcacctcccaggctacccacctgaacctgctgttaggg
ttcatgaaacagtggaagacccagctgggctctggcctggggtctggacccatggccctg
gagcggaatctgtcagacctgcagctgcagggggctgtggaggcagctggggacctagag
gtggactgctaccgggccccctgctccgagagccaggaggagctggccctgcagcacttc
atgaaggagaagctcctgactgagctggaggggaagctgtgcgtgtttgagaacattgtc
gccgtcctcaacaaggaggtggaggcctcccacctggccctggccgcctccatccaccag
agccggctgggccgtgagcacatcctgagcttggaacggagggtgatggagctgcagcag
accttggcccagaaagaccaggccctggtcaagctggagcagagcttccgcctcatggaa
gaggcctcctacgacggcacgttcctatggaaggtcaccagtgtcaccaggcggtgccat
gagtcagcctgcggcaggaccgtcagcctcttctccccagctttctacactgccaagtac
ggatacaagctgtgcctgcggctctacctgaatggggacgggacggggaagaggacccac
ctgtccctcttcatcgtgatcatgagaggggagtatgatgctctgttgccgtggcctttc
cggaacaaggtcactttcatgctgctcgaccagaacaaccgtgagcacgccatcgacgcc
ttccggcccgacctgaactcagcatccttccagcggccccagagcgaaaccaatgtggcc
agcggctgcccactcttcttccccctcaacaagctgcagtctcccaagcatgcctacgtg
aaggacgacaccatgttcctcaagtgcatcgtggagacagacgcttag

KEGG   Delphinapterus leucas (beluga whale): 111179772
Entry
111179772         CDS       T05885                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6 isoform X1
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04064  NF-kappa B signaling pathway
dle04120  Ubiquitin mediated proteolysis
dle04140  Autophagy - animal
dle04144  Endocytosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04722  Neurotrophin signaling pathway
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111179772 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111179772 (TRAF6)
   04064 NF-kappa B signaling pathway
    111179772 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111179772 (TRAF6)
   04140 Autophagy - animal
    111179772 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111179772 (TRAF6)
   04621 NOD-like receptor signaling pathway
    111179772 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    111179772 (TRAF6)
   04657 IL-17 signaling pathway
    111179772 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111179772 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111179772 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111179772 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111179772 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111179772 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111179772 (TRAF6)
   05135 Yersinia infection
    111179772 (TRAF6)
   05133 Pertussis
    111179772 (TRAF6)
   05152 Tuberculosis
    111179772 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111179772 (TRAF6)
   05161 Hepatitis B
    111179772 (TRAF6)
   05160 Hepatitis C
    111179772 (TRAF6)
   05171 Coronavirus disease - COVID-19
    111179772 (TRAF6)
   05162 Measles
    111179772 (TRAF6)
   05168 Herpes simplex virus 1 infection
    111179772 (TRAF6)
   05169 Epstein-Barr virus infection
    111179772 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111179772 (TRAF6)
   05140 Leishmaniasis
    111179772 (TRAF6)
   05142 Chagas disease
    111179772 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111179772 (TRAF6)
   04121 Ubiquitin system [BR:dle04121]
    111179772 (TRAF6)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111179772 (TRAF6)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    111179772 (TRAF6)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    111179772 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 Spc29 SlyX Tropomyosin_1 DUF3450 DUF4455 PspA_IM30 U-box AAA_13 RNase_Y_N DUF16 EzrA Med21 Spc7 UPF0242 PI3K_P85_iSH2 Laminin_II Myosin_tail_1 Tropomyosin DUF1664 ATG16 TMF_DNA_bd Sina CENP-F_leu_zip
Other DBs
NCBI-GeneID: 111179772
NCBI-ProteinID: XP_022439313
UniProt: A0A2Y9PAB2
LinkDB
Position
Unknown
AA seq 561 aa
MLLKIFLRRRKRAVDNHLTMSLLHWENSCGSSQSESDCCAAMAASSCGAAAKDESVSGTA
STVNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRD
AGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHRAHCEFALM
NCPQCQRPFQKCQLNIHIVKECPRRQVSCVNCAVSMAFEDKEIHDQNCPLANVICEYCNT
MLIREQMPNHYDLDCPTAPVPCTFSTFGCHEKMQRNHLARHLQEDTQSHMRMMAQAVQTL
SLAIAPAPQRGMLPCDSASLPRISSGCHSEVQNFQETIQQLEGRLVRQDHQIRELTAKME
TQSTYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFY
TGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAP
VRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVST
RFDMGSLRREGFQPRSTDLGI
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgctactcaaaatctttttgagaagaagaaaaagagcagtcgataatcaccttactatg
agtctgctacactgggaaaacagctgtggatccagccagtccgagagcgactgctgtgct
gccatggccgccagctcctgtggtgctgcagccaaagatgagagtgtgagtggaactgcc
agcacagtgaatctttccagctcttttatggaagagatccagggatatgacgtggaattt
gacccacccctggaaagcaagtatgaatgccccatctgcttgatggcattacgggaagca
gtgcaaacaccgtgcggccacaggttctgcaaagcctgcatcatcaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactctttcctgac
aattttgcaaaacgagagattctttctctgatggtgaagtgtccaaatgaaggttgtctg
cacaagatggaactgaggcatcttgaggatcaccgagcacattgtgagtttgctcttatg
aattgtccccaatgccaacgtcccttccaaaaatgccaacttaatattcacattgtcaag
gagtgtccaaggagacaggtttcttgtgtaaactgtgctgtatcgatggcatttgaagat
aaagagattcatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaacacc
atgctcatcagagaacagatgcctaatcattatgatctagactgtcctacagccccagtt
ccatgcacattcagtacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctgcaagaggatacccagtcgcacatgagaatgatggcccaggctgttcagacttta
agccttgcgatagctcccgcacctcagcgtggcatgctgccatgtgattctgcctctctg
ccccggatttcctctgggtgtcactcagaggtccagaatttccaagaaaccattcaacag
ttagagggtcgccttgtaagacaagaccatcaaatccgggagctgactgcaaaaatggaa
actcagagcacgtatgtaagtgagctaaaacgaactattcgaacccttgaggacaaagtt
gctgaaatagaagcacagcagtgcaatggaatttacatctggaagattggcaattttggg
atgcacttgaaatctcaagaagaggagaaacctgttgtcattcacagccccggattctac
acaggcaaacccggctacaaactatgcatgcgcctgcacctgcagctaccaactgcacag
cgctgtgccaactacatatccctcttcgtccacacgatgcaaggagagtatgacagccac
ctcccgtggcccttccagggtacgatacgccttaccatccttgatcagtctgaagcacct
gtaaggcaaaaccatgaagagataatggacgccaaaccagagctgcttgccttccagaga
cccacaatcccacggaaccccaaagggtttggctatgtgacctttatgcatctggaagcc
ctaagacaaagaaccttcatcaaggacgacacgttattagtacgctgtgaggtctccacc
cgctttgacatgggcagtcttcggagggagggttttcaaccacgaagtactgacttgggg
atatag

KEGG   Delphinapterus leucas (beluga whale): 111184706
Entry
111184706         CDS       T05885                                 

Gene name
TRAF5
Definition
(RefSeq) TNF receptor-associated factor 5 isoform X1
  KO
K09849  TNF receptor-associated factor 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04064  NF-kappa B signaling pathway
dle04217  Necroptosis
dle04621  NOD-like receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04668  TNF signaling pathway
dle05163  Human cytomegalovirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111184706 (TRAF5)
   04668 TNF signaling pathway
    111184706 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111184706 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111184706 (TRAF5)
   04657 IL-17 signaling pathway
    111184706 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184706 (TRAF5)
   05203 Viral carcinogenesis
    111184706 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111184706 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111184706 (TRAF5)
   05168 Herpes simplex virus 1 infection
    111184706 (TRAF5)
   05163 Human cytomegalovirus infection
    111184706 (TRAF5)
   05169 Epstein-Barr virus infection
    111184706 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111184706 (TRAF5)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    111184706 (TRAF5)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-TRAF_2 zf-RING_UBOX zf-ACC zf-RING_2 DUF4941 zf-RING_6 Med4 DUF4279
Other DBs
NCBI-GeneID: 111184706
NCBI-ProteinID: XP_022449151
UniProt: A0A2Y9Q0U5
LinkDB
Position
Unknown
AA seq 616 aa
MACSEEQGGVPCGFIRQNSGNSTSLDFEPDAEYQFVEQLEERYRCAFCRSVLHNPHQTGC
GHRFCQHCILSLRELNAVPLCPVDKEVIKSQEVFKDNCCKREVLNLYVFCKNAPGCNAKV
ILGRYQRWKVVKWEAGNVAPPQQAHVRFNHTMNEYEASISSFQGIARRTLQVSLPSHTFW
NVFQDHLQHCLFQAVQCSNESCREPVLRKDLKEHLSADCPFREEKCLYCKKDVVVINLQN
HEENLCPEYPVSCPNKCLQIIPRTEVDEHLAVCPEAEQDCPFKHYGCTVKDKRGNLQEHE
HSALRDHMLLVLEKNFQLEEQISDLYKSLEQKESKIQQLAETVKKFEKEFKQFAQLFGKN
GTFLSNIQVLASHIDKSAWLEVQVRQLLQMANQQQSKFDLRPLVEAIDTVKQKITLLETH
DQRLVVLEGETNKHDAHINIHKAQLNKNEERFKLLESACYNGKLIWKVTDYKLKKKEALD
GHTVSIFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRV
TLMLLDQSGKRNHIMETFKADPNSSSFKRPDGEMNIASGCPRFVAHSTLENAKNTYIKDD
TLFLKVAVDLTDLEDL
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggcttgttctgaggagcaaggaggtgtcccctgtggcttcatccgccagaattctggt
aactccacgtctttggactttgagccagatgcagagtaccagtttgtggagcagctggaa
gagcgctacagatgtgccttctgccgctcagtgcttcacaacccccaccagacgggctgt
gggcaccgcttctgccagcactgcatcctgtccctgagagaattaaacgcagtcccactc
tgccctgtagataaggaggtgatcaaatctcaggaggtgtttaaagacaattgctgcaaa
agagaagtcctcaatttatatgtattttgcaaaaacgctcctggatgtaatgccaaggtt
attctgggacgataccagcggtggaaggttgttaaatgggaagcaggaaacgtggctcca
ccacagcaagcccatgtcaggttcaatcacactatgaatgaatacgaggcaagcatctct
agcttccaaggaattgctaggaggacgctacaagtttcccttcccagccacacgttttgg
aatgtatttcaggaccaccttcagcactgcttattccaagctgtgcagtgctctaatgag
agctgtcgggagccagtccttcgcaaagatctgaaagagcatttgagtgcagactgtccg
tttcgagaggaaaaatgcctttattgcaaaaaggatgtggtagtcatcaatctacagaat
catgaggaaaacttgtgtcctgagtacccagtatcttgtcccaacaagtgtttgcagatt
attccaagaactgaggtggatgaacaccttgctgtgtgtcctgaagctgaacaagactgt
cctttcaagcactatggctgtactgtaaaggataaacgaggaaacctgcaggagcatgag
cattcagccttacgggaccacatgcttctggttttagaaaagaacttccagttagaagaa
cagatttctgacttatataagagcctagaacaaaaagaaagtaaaatccagcagctagca
gaaaccgtaaagaaattcgaaaaggagttcaagcagtttgcacagttgtttggcaaaaat
ggaactttcctctcaaatatacaggttcttgccagtcacattgacaagtccgcttggcta
gaagttcaggtgcgtcagttattacaaatggctaaccagcaacaaagtaaatttgatctg
aggcctttggtggaagcgattgatacagtgaaacagaaaatcaccctgctagaaacccat
gatcaaagattagttgttttggaaggggagactaacaaacatgatgcccacattaatatt
cataaagcacagctgaataaaaacgaagagcgatttaagctgctagaaagtgcctgctat
aacggaaagctcatctggaaggtcacagactacaagctgaagaagaaggaggcgctggac
ggacacacagtatccatcttcagccagcccttctacaccagccggtgtggctacaggctc
tgcgctagagcgtacctgaatggggacgggtctgggaaggggacgcacctgtcgttgtac
tttgtggtgatgcgaggggagtttgactcactgttgcagtggccattcaggcagagggtg
accctgatgcttttggaccaaagtggcaaaaggaaccacattatggagaccttcaaggct
gaccccaatagcagcagctttaaaagacccgatggggagatgaacattgcctctggctgt
ccacgcttcgtggctcattccactttggagaatgccaagaacacctacattaaagatgac
accctgttcttgaaagtggctgtggatttaactgacctggaggatctctaa

KEGG   Delphinapterus leucas (beluga whale): 111185690
Entry
111185690         CDS       T05885                                 

Gene name
TRAF4
Definition
(RefSeq) TNF receptor-associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04657  IL-17 signaling pathway
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    111185690 (TRAF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111185690 (TRAF4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111185690 (TRAF4)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-Nse zf-C3HC4_4 zf-RING_5 zf-TRAF_2 zf-RING_2 zf-RING_6 zf-C3HC4_3 zf-rbx1
Other DBs
NCBI-GeneID: 111185690
NCBI-ProteinID: XP_022451183
UniProt: A0A2Y9Q6V6
LinkDB
Position
Unknown
AA seq 470 aa
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAFESHEGVCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVPCPNQCGVGTMAREDLPGHLK
DSCSTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcccggctttgactacaagttcttggagaagcccaagcggcggctgctgtgcccgctg
tgcgggaagcccatgcgcgagcccgtgcaggtttctacctgcggccaccgcttctgcgac
acctgcctgcaggagttcctcagtgaaggagtcttcaagtgccctgaggatcaacttcct
ctggactatgccaagatctacccagacccagagctggaggtacaggtactgggcctgcct
atccgctgcatccacagtgaggagggctgccgctggagtgggccacttcgccacctacag
ggccacctgaatacgtgcagcttcaatgtagtcccctgccccaaccgctgccccgccaag
ctgagccgccgggatctgcccgcgcacctgcagcacgactgccccaagaggcgactcaag
tgcgagttctgtggctgtgacttcagcggggaggcctttgagagccacgaaggtgtgtgc
ccgcaagagagtgtgtactgtgagaacaaatgcggtgcccgcatgatgcggcggctcctg
gcccagcatgccacctctgagtgccccaagcgcacccagccttgcacttactgcaccaag
gagtttgtctttgacaccatccagagccaccagtaccagtgcccgaggctgcctgtgcca
tgccccaaccagtgtggcgtgggcaccatggctcgggaggatctgccgggccacctcaag
gacagctgtagcactgccctggtgctgtgcccattcaaagactccggctgcaagcacagg
tgccctaagctggcaatggcacggcacgtggaggagagcgtgaagccacatctggccatg
atgtgtgccctggtgagccggcaacggcaagagctgcaggagctgcgaagagagctggag
gagctctccgtgggcagtgatggcgtgctcatctggaagatcggcagttacgggcgaagg
ctgcaggaggccaaagccaagcccaacctcgagtgcttcagccccgccttctacacgcat
aagtatggctacaagctgcaggtgtctgcattcctcaatggcaatggcagtggtgagggt
acacatctctcgctctacattcgcgtgctgccaggtgcctttgacaatctccttgagtgg
ccctttgcccgccgcgtcaccttctccctgctggatcagagcgaccctgggctggctaag
ccacagcatgtcactgagacctttcaccctgacccaaactggaagaatttccaaaaacca
ggcacttggcggggctccctggatgagagttctctgggctttggttaccccaagttcatc
tcccaccaggatatccgcaagcgaaactatgtgcgggatgatgcagtcttcatccgtgcc
tctgttgaattgccccgaaagatcctcagctga

DBGET integrated database retrieval system