KEGG   Delphinapterus leucas (beluga whale): 111176089Help
Entry
111176089         CDS       T05885                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04080  Neuroactive ligand-receptor interaction
dle04972  Pancreatic secretion
dle04974  Protein digestion and absorption
dle05164  Influenza A
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111176089
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    111176089
   04974 Protein digestion and absorption
    111176089
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    111176089
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dle01002]
    111176089
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111176089
Enzymes [BR:dle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     111176089
Peptidases [BR:dle01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   111176089
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111176089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 111176089
NCBI-ProteinID: XP_022431819
UniProt: A0A2Y9NAE9
LinkDB All DBs
Position
Unknown
AA seq 282 aa AA seqDB search
MGVNDKPDGINSCGWKPFSIVPSPDPGSNHDDLHLSCSHGSRCSNFSLSVALPTDDDDKI
VGGYTCEAHSIPYQVSLNSGYHFCGGSLISDQWVVSAAHCYKSRMKVGLGAHNIEVLEGN
EQFIKAAKIIVHPKYNRKTLDNDIMLIKLDPPATLNNQVAAVPLPTRCAAAGTQCLISGW
GNTKSSGSSFPELLQCLEAPILSDSVCHSAYPKQISRNMMCLGFLEGGKDSCQGDSGGPV
VCNGQLQGIVSWGYGCALKGKPGVYTKVCNYLSWIQKTIADN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcaatgacaaacctgatggtataaatagctgtggatggaaacccttcagcata
gtccctagtccagatccggggagcaaccatgacgaccttcatctttcttgctctcatggg
agtcgctgctccaacttctctctgtcagttgctctccccactgacgatgacgacaagatt
gtcgggggctacacctgtgaagcgcattctatcccctaccaggtgtccctgaactccggc
taccacttctgcgggggctccctcatcagtgaccagtgggtggtatccgcggctcactgc
tacaagtcccgaatgaaggtgggcctgggagcacacaacattgaggtccttgagggcaat
gagcaattcatcaaagcagccaagatcatcgtccatcccaagtacaacagaaagaccttg
gataacgacatcatgctgattaaactggacccacctgccactctcaacaatcaagtagcc
gctgtccctctgccaacacgttgtgcagctgctggtacccagtgtctcatctctggctgg
ggcaacaccaagagcagtggctccagcttccctgagctcctgcagtgtctggaagctccc
atcctgtctgacagcgtttgccacagtgcctatcccaaacagatctccagaaacatgatg
tgcctgggcttcctggagggcggaaaggactcttgccagggtgactctggtggccctgtg
gtctgcaatggacagctccagggcattgtctcctggggctatggctgcgctctgaaaggc
aaacctggtgtctacactaaggtctgcaactacctgagctggattcagaagactatcgct
gacaactaa

DBGET integrated database retrieval system