KEGG   Delphinapterus leucas (beluga whale): 111176204
Entry
111176204         CDS       T05885                                 

Gene name
SNW1
Definition
(RefSeq) SNW domain-containing protein 1
  KO
K06063  SNW domain-containing protein 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03040  Spliceosome
dle04330  Notch signaling pathway
dle05169  Epstein-Barr virus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111176204 (SNW1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111176204 (SNW1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111176204 (SNW1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111176204 (SNW1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dle03041]
    111176204 (SNW1)
Spliceosome [BR:dle03041]
 Complex B
  Other components
   Prp19-related factors
    111176204 (SNW1)
 Complex C
    111176204 (SNW1)
SSDB
Motif
Pfam: SKIP_SNW
Other DBs
NCBI-GeneID: 111176204
NCBI-ProteinID: XP_022432136
UniProt: A0A2Y9NGN8
LinkDB
Position
Unknown
AA seq 536 aa
MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDAEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQNIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcgctcaccagctttttacctgcacctactcagctatctcaggaccagcttgaggct
gaagaaaaagcaagatcgcagagatcacgacagacctcactggtctcctctcgaagagaa
cctcccccatacgggtaccggaaaggctggatacctcggttattagaggattttggagat
ggaggtgcttttccagagatccacgtggcccagtatcccctggatatgggacgaaagaaa
aaaatgtcaaatgcactggccattcaggtggatgctgaaggaaaaattaagtatgatgca
attgctcgacagggacagtcaaaagacaaggtcatttatagcaagtacactgacctggtt
cccaaagaagtcatgaatgcagatgacccagacctgcaaagacctgatgaagaagccatt
aaagagataacagaaaagacaagggtagccttagaaaaatccgtatcgcagaaggttgct
gcagccatgccagtccgagcagctgataaactggctcctgctcagtatatccgatacaca
ccatctcaacaaggagtggctttcaactctggagctaaacagagagttattcgaatggtg
gaaatgcagaaagatccgatggaacctccaaggttcaagattaataagaaaattccccgg
ggaccaccttctcctcctgcacctgtcatgcattctcctagccgaaagatgaccgtgaag
gaacaacaagagtggaagattcctccctgtatttcaaactggaaaaatgcaaagggttat
acaattccattagataaacgtctggcagctgatggaagaggactgcagacagttcacatc
aatgaaaattttgcaaaactggccgaagccctctacattgctgatcggaaggctcgtgaa
gctgtggaaatgcgtgctcaagtagagagaaagatggctcaaaaagaaaaggagaaacat
gaagagaaacttagagaaatggcccagaaagccagggagagaagagctgggatcaaaacc
catgtggaaaaagaggatggggaggcacgtgagagggatgaaatccggcatgacaggcga
aaagagagacagcatgaccggaatctttccagggcagctccagataagaggtcgaaactg
cagagaaatgaaaatcgagatatcagcgaagtcattgctctgggtgtgcccaatcctcgg
acttccaatgaagttcagtatgaccaaaggctcttcaaccaatccaagggtatggacagt
ggttttgcaggtggagaagatgaaatttacaatgtttatgatcaagcctggagaggtggt
aaagatatggcccagaatatttacaggcccagtaaaaatctggacaaggacatgtatggt
gatgacctagaagccagaataaagactaacagatttgttcccgataaggagttttctggt
tcagaccgtagacaaagaggccgagaaggaccagttcagtttgaggaggatccttttggt
ttggacaaatttttggaagaagccaaacagcacggtggctctaaaagaccctcagatagc
agccgccccaaggaacatgagcatgaaggcaagaagaggagaaaggagtag

DBGET integrated database retrieval system