KEGG   Delphinapterus leucas (beluga whale): 111176232
Entry
111176232         CDS       T05885                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 proprotein
  KO
K13377  transforming growth factor beta-3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04060  Cytokine-cytokine receptor interaction
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04218  Cellular senescence
dle04350  TGF-beta signaling pathway
dle04390  Hippo signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05220  Chronic myeloid leukemia
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05321  Inflammatory bowel disease
dle05323  Rheumatoid arthritis
dle05410  Hypertrophic cardiomyopathy
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111176232 (TGFB3)
   04350 TGF-beta signaling pathway
    111176232 (TGFB3)
   04390 Hippo signaling pathway
    111176232 (TGFB3)
   04068 FoxO signaling pathway
    111176232 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111176232 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111176232 (TGFB3)
   04218 Cellular senescence
    111176232 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111176232 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111176232 (TGFB3)
   05212 Pancreatic cancer
    111176232 (TGFB3)
   05225 Hepatocellular carcinoma
    111176232 (TGFB3)
   05226 Gastric cancer
    111176232 (TGFB3)
   05220 Chronic myeloid leukemia
    111176232 (TGFB3)
   05211 Renal cell carcinoma
    111176232 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111176232 (TGFB3)
   05321 Inflammatory bowel disease
    111176232 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111176232 (TGFB3)
   05414 Dilated cardiomyopathy
    111176232 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111176232 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111176232 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111176232 (TGFB3)
   05161 Hepatitis B
    111176232 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111176232 (TGFB3)
   05144 Malaria
    111176232 (TGFB3)
   05145 Toxoplasmosis
    111176232 (TGFB3)
   05140 Leishmaniasis
    111176232 (TGFB3)
   05142 Chagas disease
    111176232 (TGFB3)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111176232 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 111176232
NCBI-ProteinID: XP_022432218
UniProt: A0A2Y9NS56
LinkDB
Position
Unknown
AA seq 456 aa
MHLLAKPQSSGSREAAWFSSLLLHVCWGLLLTRPRSPRASLPCSRMKMHLQRALVVLALL
NFATVSLSMSTCTTLDFDHIKRKRVEAIRGQILSKLRLTSPPDPSVLANIPTQVLDLYNS
TRELLEEVHGERGDDCTQENTESEYYAKEIYKFDMIHGLEEHNDLAVCPKGITSKIFRFN
VSSVEKNETNLFRAEFRVLRMPNPSSKRSEQRIELFQILQPDEHIAKQRYLDGKNLPTRG
TAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIQEVMEIKFKGVDS
EDDPGRGDLGRLKKKKEHSPHLILMMIPPDRLDNPGQGGQRKKRALDTNYCFRNLEENCC
VRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSSVLGLYNTLNPEASASP
CCVPQDLEPLTILYYVGRTAKVEQLSNMVVKSCKCS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtcttcgggatctagggaggccgcctggttttcctcc
ctccttctgcacgtctgctggggtctcctcctcaccaggcctcgcagcccccgggcctct
ctcccctgctcacgcatgaagatgcacttgcaaagggctctggtggtcctggccctgctg
aactttgccacggtcagtctctccatgtccacttgcaccaccttggacttcgaccacatc
aagaggaagcgggtggaagccattaggggacagatcttgagcaaactcaggctcaccagt
ccccccgatccatcggtgttggccaacatccccacccaggtcctggacctttacaacagc
acccgagagctgctggaagaggtgcacggggagaggggagacgactgcactcaggaaaac
actgagtcggagtactatgccaaagaaatctataaattcgacatgatccacgggctggag
gagcacaatgacctggccgtctgtcccaaaggaatcacgtccaagattttccgcttcaac
gtgtcctcagtggagaaaaatgaaaccaacctgttccgagcggaattccgggtcttgcgg
atgcccaaccccagctccaagcgcagcgagcagaggattgagctcttccagatcctccag
ccggatgagcacatagccaagcagcgctatcttgatggcaagaatctgcccacgcggggc
actgctgagtggctgtctttcgacgttacagacactgtgcgtgaatggctcttacgaaga
gaatccaacttaggtctggaaatcagcattcattgtccatgtcacacctttcagcccaat
ggggatatcctggaaaacattcaagaggtgatggaaatcaagttcaaaggtgtggacagt
gaggatgatccaggcagaggagatctggggcgactgaagaagaaaaaggaacacagccct
catttaatcctcatgatgattcccccagaccggctggacaacccaggccagggaggtcag
aggaagaagcgggccctggacaccaattactgcttccgcaatctggaggagaactgctgt
gtgcgccctctctacattgacttccgacaggatctgggctggaaatgggtccatgaacct
aagggctactacgccaacttctgctcaggcccgtgcccatacctccgcagcgcagacact
acccacagctcagtgctgggactgtacaacaccctgaaccctgaagcctcggcctcccct
tgctgcgtaccccaggacttggagcccctgaccatcctgtactatgtcgggaggaccgcc
aaggtggagcagctctctaacatggtggtgaagtcctgcaagtgcagctga

KEGG   Delphinapterus leucas (beluga whale): 111177477
Entry
111177477         CDS       T05885                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04060  Cytokine-cytokine receptor interaction
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04218  Cellular senescence
dle04350  TGF-beta signaling pathway
dle04380  Osteoclast differentiation
dle04390  Hippo signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05220  Chronic myeloid leukemia
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05321  Inflammatory bowel disease
dle05323  Rheumatoid arthritis
dle05410  Hypertrophic cardiomyopathy
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111177477 (TGFB2)
   04350 TGF-beta signaling pathway
    111177477 (TGFB2)
   04390 Hippo signaling pathway
    111177477 (TGFB2)
   04068 FoxO signaling pathway
    111177477 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111177477 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111177477 (TGFB2)
   04218 Cellular senescence
    111177477 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111177477 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177477 (TGFB2)
   05206 MicroRNAs in cancer
    111177477 (TGFB2)
   05205 Proteoglycans in cancer
    111177477 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111177477 (TGFB2)
   05212 Pancreatic cancer
    111177477 (TGFB2)
   05225 Hepatocellular carcinoma
    111177477 (TGFB2)
   05226 Gastric cancer
    111177477 (TGFB2)
   05220 Chronic myeloid leukemia
    111177477 (TGFB2)
   05211 Renal cell carcinoma
    111177477 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111177477 (TGFB2)
   05321 Inflammatory bowel disease
    111177477 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111177477 (TGFB2)
   05414 Dilated cardiomyopathy
    111177477 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111177477 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111177477 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111177477 (TGFB2)
   05161 Hepatitis B
    111177477 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111177477 (TGFB2)
   05144 Malaria
    111177477 (TGFB2)
   05145 Toxoplasmosis
    111177477 (TGFB2)
   05140 Leishmaniasis
    111177477 (TGFB2)
   05142 Chagas disease
    111177477 (TGFB2)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111177477 (TGFB2)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111177477 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 111177477
NCBI-ProteinID: XP_022434950
UniProt: A0A2Y9NLP6
LinkDB
Position
Unknown
AA seq 442 aa
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCYRQPQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttcttctcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcggacagatcctgagcaagctgaaactcaccagccccccagaagactatcccgaaccc
gaagaggtccccccggaggtgatttccatctacaacagcacaagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctacagacagccccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcaggattgtccgattt
gacgtctccgccatggagaagaatgcttccaatttggtgaaggcagagttcagagtcttt
cgtttacagaacccgaaagccagagtgcctgaacaacggatcgaactgtatcagattctc
aaatccaaagatttaacatctccaacccagcgctacatcgacagcaaagtcgtgaaaacc
agagcagaaggcgaatggctctccttcgatgtcactgatgctgttcacgaatggctccac
cataaagacaggaatctgggatttaaaataagtttacactgtccctgctgcacctttgta
ccatcgaataattacatcatccccaacaaaagtgaagaactagaagcgcgatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaacaataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttaccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgctttggatgcagcctattgctttagaaat
gtgcaggataattgttgcctacgcccactttacattgatttcaagagggatcttgggtgg
aaatggatacatgagcctaaagggtacaatgccaacttctgtgctggagcgtgcccatat
ctgtggagctcagacactcagcacagtagggttctcagcttatataataccataaatcca
gaagcatctgcttccccttgctgcgtgtcccaggatttagaaccgctcaccattctctac
tacatcggcaaaacacccaagattgaacagctttctaatatgatcgtaaagtcttgcaaa
tgcagctaa

KEGG   Delphinapterus leucas (beluga whale): 111180824
Entry
111180824         CDS       T05885                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 proprotein isoform X1
  KO
K13375  transforming growth factor beta-1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04060  Cytokine-cytokine receptor interaction
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04218  Cellular senescence
dle04350  TGF-beta signaling pathway
dle04380  Osteoclast differentiation
dle04390  Hippo signaling pathway
dle04659  Th17 cell differentiation
dle04672  Intestinal immune network for IgA production
dle04926  Relaxin signaling pathway
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05220  Chronic myeloid leukemia
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05321  Inflammatory bowel disease
dle05323  Rheumatoid arthritis
dle05410  Hypertrophic cardiomyopathy
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111180824 (TGFB1)
   04350 TGF-beta signaling pathway
    111180824 (TGFB1)
   04390 Hippo signaling pathway
    111180824 (TGFB1)
   04068 FoxO signaling pathway
    111180824 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111180824 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111180824 (TGFB1)
   04218 Cellular senescence
    111180824 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111180824 (TGFB1)
   04672 Intestinal immune network for IgA production
    111180824 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111180824 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111180824 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180824 (TGFB1)
   05205 Proteoglycans in cancer
    111180824 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111180824 (TGFB1)
   05212 Pancreatic cancer
    111180824 (TGFB1)
   05225 Hepatocellular carcinoma
    111180824 (TGFB1)
   05226 Gastric cancer
    111180824 (TGFB1)
   05220 Chronic myeloid leukemia
    111180824 (TGFB1)
   05211 Renal cell carcinoma
    111180824 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111180824 (TGFB1)
   05321 Inflammatory bowel disease
    111180824 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111180824 (TGFB1)
   05414 Dilated cardiomyopathy
    111180824 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111180824 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111180824 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111180824 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111180824 (TGFB1)
   05161 Hepatitis B
    111180824 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111180824 (TGFB1)
   05144 Malaria
    111180824 (TGFB1)
   05145 Toxoplasmosis
    111180824 (TGFB1)
   05140 Leishmaniasis
    111180824 (TGFB1)
   05142 Chagas disease
    111180824 (TGFB1)
Chaperones and folding catalysts [BR:dle03110]
 Intramolecular chaperones
  Others
   111180824 (TGFB1)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111180824 (TGFB1)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111180824 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 111180824
NCBI-ProteinID: XP_022441295
UniProt: A0A2Y9P5D5
LinkDB
Position
Unknown
AA seq 391 aa
MPPSGLRLLPLLLPLLWLLVLPPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVENSNEI
YGKIKRSPHSMYMLFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNDSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLTHGEEIEGFRLSAHCSCDSKDNTLQVDINAGF
SSGRRGDLATIHGMNRPFLLLMATPLERAQHLHSPRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctgctgccgctgctgctgccgctgctgtggctactagtg
ctgccgcctggccggccggccgccggactgtccacctgcaagaccatcgacatggagctg
gtgaagcgaaagcgcatcgaggccatccgcggccagattctgtccaagcttcggctcgcc
agccccccgagccagggggaggtgccgcccggtccgctgcccgaggccgtactggccctt
tacaacagtacccgtgaccgggtggccggggaaagtgccgaacctgagcctgagccagag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacagcaacgaaatc
tatgggaaaatcaagcgtagcccacacagcatgtatatgctcttcaacacgtcggagctc
cgggaagcggtgcccgaacctgtgttgctctctcgggcagagctacgcctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaatgattcctggcgc
tacctcagcaaccggctgctggcccccagcgactcgccggagtggctgtcctttgacgtc
actggagttgtgcggcagtggctgacccacggagaggaaatagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataacacactccaagtggacattaacgcagggttc
agttccggccgccggggtgacctcgccaccattcatggcatgaaccggcccttcctgctc
ctcatggccaccccgctggagagggcccagcacctgcacagcccccggcaccgccgagcc
ctggacaccaactactgcttcagctctacggaaaagaactgctgcgttcggcagctctac
attgacttccgcaaggacctgggctggaagtggattcacgaacccaagggctaccacgcc
aatttctgcctggggccctgcccctacatctggagcctggacacgcagtacagcaaggtc
ctggccctgtacaaccagcacaacccgggcgcgtcggcggcgccgtgctgcgtgccgcag
gcgctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system