KEGG   Delphinapterus leucas (beluga whale): 111176269
Entry
111176269         CDS       T05885                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog protein isoform X2
  KO
K11988  sonic hedgehog
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04340  Hedgehog signaling pathway
dle04360  Axon guidance
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05217  Basal cell carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    111176269 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    111176269 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111176269 (SHH)
   05205 Proteoglycans in cancer
    111176269 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    111176269 (SHH)
   05217 Basal cell carcinoma
    111176269 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111176269 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111176269 (SHH)
Peptidases and inhibitors [BR:dle01002]
 Cysteine peptidases
  Family C46: hedgehog family
   111176269 (SHH)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Morphogens
   111176269 (SHH)
SSDB
Motif
Pfam: Hint HH_signal Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 111176269
NCBI-ProteinID: XP_022432306
UniProt: A0A2Y9NH78
LinkDB
Position
Unknown
AA seq 345 aa
MNQWPGVKLRVTEGWDEDGHHSEEALHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWV
YYESKAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDEGRL
LYSDFLTFLDRDHGAKKVFYAIETREPRERLLLTAAHLLFVAPHNGSAGREPEALSGAGR
PPGGAPERRALFASSVRPGQHVYVVAERGGDRRLLPAAVHSVTLREESTGAYAPLTAQGT
ILINRVLASCYAVIEEHNWAHRAFAPYRLAHALLAALAPSRTDRGGGGGGGRVPPAAPGA
PAAPGATDAPGASGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaaccagtggccaggagtgaagctgcgggtgacagagggctgggacgaggacggccac
cactcagaggaggcgctgcactacgagggccgtgcagtggacatcaccacctcggaccgc
gaccgcagcaagtacggcatgctggcacgcctggccgtggaggccggcttcgactgggtc
tactacgagtccaaagcgcacatccactgctcggtgaaagcagagaactcggtggccgcc
aaatcgggcggctgcttcccgggctcggccacggtgcacctggagcagggcggcaccaag
ctggtgaaggacctgcgccccggagaccgcgtgctggcggccgacgacgagggccggctg
ctctacagcgacttcctcaccttcctggaccgcgaccacggcgccaagaaggtcttctac
gcgatcgagacccgggagcctcgcgagcgtctgctgctcaccgccgcgcacctgctcttt
gtcgcgccgcacaacggctcggccggccgggagcccgaggcgctgtcgggcgccgggcgg
ccgcctgggggcgcgccggagcgccgggcgctcttcgccagcagcgtgcgccctggccaa
cacgtgtacgtggtggccgagcgcggcggggatcggcggctcctgccggccgccgtgcac
agcgtgacgctgcgcgaggagagcacgggcgcgtacgcgccgctgacggctcagggcacc
atcctcatcaaccgggtgctggcgtcgtgctacgcggtcatagaggagcacaactgggcg
caccgggccttcgcgccctaccgcctggcgcacgcgctcctggccgcgctggcgccctcg
cgcacggaccgcggcgggggcgggggcggcggccgcgtgcccccggccgcgccaggtgcg
ccggctgcgccaggtgcgaccgacgcgccaggcgcctcgggcatccactggtactcgcag
ctgctctaccaaataggcacctggctgttggacagcgaggccttgcacccgctcggcatg
gcggtcaagtccagctga

DBGET integrated database retrieval system