KEGG   Delphinapterus leucas (beluga whale): 111176587
Entry
111176587         CDS       T05885                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04071  Sphingolipid signaling pathway
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04650  Natural killer cell mediated cytotoxicity
dle04932  Non-alcoholic fatty liver disease
dle05010  Alzheimer disease
dle05014  Amyotrophic lateral sclerosis
dle05022  Pathways of neurodegeneration - multiple diseases
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    111176587 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111176587 (BID)
   04215 Apoptosis - multiple species
    111176587 (BID)
   04217 Necroptosis
    111176587 (BID)
   04115 p53 signaling pathway
    111176587 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111176587 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111176587 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111176587 (BID)
   05014 Amyotrophic lateral sclerosis
    111176587 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    111176587 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111176587 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111176587 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111176587 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111176587 (BID)
   05161 Hepatitis B
    111176587 (BID)
   05160 Hepatitis C
    111176587 (BID)
   05164 Influenza A
    111176587 (BID)
   05162 Measles
    111176587 (BID)
   05168 Herpes simplex virus 1 infection
    111176587 (BID)
   05163 Human cytomegalovirus infection
    111176587 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111176587 (BID)
   05169 Epstein-Barr virus infection
    111176587 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111176587 (BID)
SSDB
Motif
Pfam: BID DUF3349
Other DBs
NCBI-GeneID: 111176587
NCBI-ProteinID: XP_022432843
UniProt: A0A2Y9NTR1
LinkDB
Position
Unknown
AA seq 193 aa
MDSKVSNGASPQDERTTGLLVFSFLQSCPHSRCRQELEMLGHKLPVRAAHDDELQTDGNW
CSHFRVEGATETDSETQEEVVRDIARQLAQIGDRMECSICPGLVAGLAAQFGNTSLSEED
RRRCLAAALQQLTQLYPADVDREKTLLLLTLLVAKKVADHSPAVLQDVFHTTVTFINQNL
LAYVRNLVQNEMD
NT seq 582 nt   +upstreamnt  +downstreamnt
atggactcgaaggtcagcaatggcgccagcccccaggatgagcgcaccacaggcctgctg
gtgttcagcttcctccagagctgcccgcactcccgttgccgccaggagctggagatgctg
ggccacaagctgcccgtgcgcgcggcccacgacgacgagctgcagacggatggcaactgg
tgcagccacttccgtgttgagggggcgacagagacagactctgagactcaggaggaagtg
gtccgggacatcgccaggcagctcgcccagattggggacaggatggagtgcagcatctgt
ccggggctggtggctggcctggccgcgcagttcggtaacacgagcctgtcggaggaggac
aggaggcggtgcctggcggccgcgctgcaacagctcacacagctctaccctgcggatgtg
gaccgcgagaagaccctgctcctgctgaccctgctcgtggccaaaaaggtggctgaccac
tcgccagctgtgctccaagatgtctttcacaccacagtgaccttcatcaaccagaacctt
ctcgcctacgtgaggaacttagtccaaaacgagatggactga

DBGET integrated database retrieval system