KEGG   Delphinapterus leucas (beluga whale): 111176594
Entry
111176594         CDS       T05885                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04020  Calcium signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04260  Cardiac muscle contraction
dle04261  Adrenergic signaling in cardiomyocytes
dle04270  Vascular smooth muscle contraction
dle04713  Circadian entrainment
dle04720  Long-term potentiation
dle04723  Retrograde endocannabinoid signaling
dle04724  Glutamatergic synapse
dle04725  Cholinergic synapse
dle04726  Serotonergic synapse
dle04727  GABAergic synapse
dle04728  Dopaminergic synapse
dle04742  Taste transduction
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04921  Oxytocin signaling pathway
dle04924  Renin secretion
dle04925  Aldosterone synthesis and secretion
dle04927  Cortisol synthesis and secretion
dle04929  GnRH secretion
dle04930  Type II diabetes mellitus
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05031  Amphetamine addiction
dle05410  Hypertrophic cardiomyopathy
dle05412  Arrhythmogenic right ventricular cardiomyopathy
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111176594 (CACNA1C)
   04020 Calcium signaling pathway
    111176594 (CACNA1C)
   04024 cAMP signaling pathway
    111176594 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    111176594 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111176594 (CACNA1C)
   04929 GnRH secretion
    111176594 (CACNA1C)
   04912 GnRH signaling pathway
    111176594 (CACNA1C)
   04921 Oxytocin signaling pathway
    111176594 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    111176594 (CACNA1C)
   04924 Renin secretion
    111176594 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    111176594 (CACNA1C)
   04927 Cortisol synthesis and secretion
    111176594 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111176594 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    111176594 (CACNA1C)
   04270 Vascular smooth muscle contraction
    111176594 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    111176594 (CACNA1C)
   04727 GABAergic synapse
    111176594 (CACNA1C)
   04725 Cholinergic synapse
    111176594 (CACNA1C)
   04728 Dopaminergic synapse
    111176594 (CACNA1C)
   04726 Serotonergic synapse
    111176594 (CACNA1C)
   04720 Long-term potentiation
    111176594 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    111176594 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    111176594 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111176594 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111176594 (CACNA1C)
   05020 Prion disease
    111176594 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    111176594 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    111176594 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111176594 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111176594 (CACNA1C)
   05414 Dilated cardiomyopathy
    111176594 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111176594 (CACNA1C)
   04934 Cushing syndrome
    111176594 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dle04040]
    111176594 (CACNA1C)
Ion channels [BR:dle04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111176594 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 111176594
NCBI-ProteinID: XP_022432865
UniProt: A0A2Y9NFP5
LinkDB
Position
Unknown
AA seq 2255 aa
MQPPDQRGCAFCLFQEVAPQGLGVRRGTCGAGQGGRGSAGHFLRLCLGLRACPRAEASED
QSARRTHTRGPQHDLPSPTSHPLSGPSYGSPRPAHANMNANAAAGLAPEHIPTPGAALSW
QAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTMATRPPRALLCLTLRNP
VRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTV
EAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFD
VKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMG
KMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFA
MLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIVGSFFVLNLVLGVLSGEFSKER
EKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGLDEEKPRNMSMPTSETE
SVNTENVAGGDIEGESCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSSVFYWLVIF
LVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKTYSLGLQAYFVSLFNRFD
CFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIA
SLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVM
YDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEE
KERKKLARTASPEKRQEVVEKPAVEETKEEKIELKSITADGESPPATKINMDDLQPNENE
DKSSYPNLETTGDEEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPSNRFRLQC
HRIVNDSIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKIL
GNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINV
VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKG
KLYTCSDSSKQTEAECKGNYVTYKDGEVDHPIVQPRSWENSKFDFDNVLAAMMALFTVST
FEGWPELLYRSIDSHTEDKGPIYNYRVEISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQG
EQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNT
ICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDCLIVIG
SVIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSRISI
TFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKI
ALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGSSAEGEA
PCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYD
PEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFAL
VRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQ
EYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDLGPEIRRAISGDLTAEEELDKAMKE
AVSTASEDDIFRRAGGLFGNHVGYYPSDSRSTFPQTFTTQRPLHISKAGTSQGGAESPSH
EKLVDSTFTPSSYSSMGSNANINNANNTALGRCPCPAGQPGAVSVSTVEGRGPPLSPAVQ
VQGASWRLSSKRRPSRDSLIAMVCQDEAPRDETCDLRMDEDAEYGSEPSLICTEMLSYQD
DENRQLAPPEEDRRDIHLSPKRGFLRSASLGRRASFHLECLKRQKNPGGDISQKTVLPLH
LVHHQALAVAGLSPLLQRSHPPGALSPPHATPPATPGPAWPLRPVPTLRLEGAESSDKLT
SSFPSVHCGPWAGEPTPCGASGGIRRARPVSLTVPSPAGPQGRPFHGSASSLVEAVLISE
GLGQFAQDPRFLEATTQELADACDMTIEEMESAADNILSGGARQSPNGTLLPCANCRDPG
PDREGGAEDAAWAPSPEPHQGGEESRDSRAFASSL
NT seq 6768 nt   +upstreamnt  +downstreamnt
atgcagcccccagaccagagggggtgtgctttctgcctcttccaggaggtggcgccccag
ggcttgggagtcaggaggggcacctgcggggctgggcaaggtggccgaggctccgcaggg
cacttcttgcggctgtgcctcggtctgcgtgcctgccccagggcggaggcctccgaagac
cagagtgcccgccgcacgcacaccaggggcccccagcacgacctgccctcgccgacctct
caccctctctccggtcccagctatgggagcccacgcccggctcatgccaacatgaatgcc
aacgcggccgcggggctggcacctgagcacatccccacaccgggggccgccctgtcctgg
caggcagccattgacgcggcccggcaggccaagctgatgggcagcgctggcaacgccacc
atctccacggtcagctccacgcagcggaagcggcagcagtacgggaagcccaagaaacag
ggcagcacgatggccacccgcccgccccgtgccctgctctgcctgaccctcaggaacccc
gtccggagggcgtgcatcagcatcgtcgagtggaagccatttgaaatcattattttactg
actatttttgccaactgtgtggccctagcgatctatattccctttccagaggacgactcc
aacgccaccaactccaacctggaacgggtggagtatctctttctcatcatttttactgtg
gaagcatttttaaaagtcatagcctatgggctgctctttcaccccaatgcttacctccgc
aacggctggaacttgctggattttatcattgtggttgtcgggcttttcagtgcaatctta
gagcaagccaccaaagccgacggggccaacgccctgggagggaagggggctggattcgac
gtgaaggcgctcagggcgttccgcgtgctgcggcccctgcggctggtgtccggggtcccg
agtctccaggtggttctgaactccatcatcaaggccatggtacccctgctgcacatcgcc
ctgcttgtgctctttgttattatcatctacgccatcatcgggctggagctcttcatgggg
aaaatgcacaagacctgctacaaccaggagggcatcgcagatgtcccagcagaagacgac
ccctccccctgtgccctggagacgggccacgggcggcagtgccagaatggcacggtgtgc
aagccgggctgggatgggcccaagcacggcatcaccaacttcgacaactttgccttcgcc
atgctgaccgtgttccagtgcatcaccatggagggctggaccgacgtcctctactgggtc
aatgatgccgtgggaagggactggccctggatctattttgtcacgctaatcatcgtaggg
tcattttttgtacttaacttggtcctcggtgtccttagcggagagttttccaaagagagg
gagaaggccaaggcccggggcgacttccagaagctgcgggagaagcagcagctggaagag
gacctgaagggctacctggactggatcacgcaggcagaggacatcgaccccgagaacgag
gacgagggcttggacgaggagaaaccccgaaacatgagcatgcccaccagtgagaccgag
tctgtcaacacggaaaacgtggctggaggcgacatcgagggagagagctgcggggccagg
ctggcccacaggatctccaagtcgaagttcagccgctactggcgccgctggaatcggttc
tgcaggaggaaatgccgcgcggccgtgaagtcgagcgtcttctactggcttgtcatcttc
ctggttttcctcaacacgctcaccatcgcctctgagcactacaaccagccccactggctc
acggaagtccaagacacagccaacaaggcgctgctggccctgttcacggcggagatgctg
ctcaagacgtacagcctggggctgcaggcctacttcgtgtccctgttcaaccgcttcgac
tgcttcatcgtgtgtggcggcatcctggagaccatcctggtggagaccaggatcatgtcg
cccctgggcatctccgtgctgagatgcgtgcgcctcctgaggatattcaagatcacgagg
tactggaactcgctgagcaacctggtggcgtccctgctgaactccgtgcgctccatcgcc
tccctgcttctgctgctgtttctcttcatcatcatcttctccctcctgggcatgcagctc
ttcggggggaagttcaacttcgatgagatgcagacccggaggagcacgttcgataacttc
ccccagtccctcctcaccgtgtttcagatcctgaccggggaggactggaattcggtgatg
tatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgtatttac
ttcatcatcctcttcatctgtggaaattatatcctactgaatgtgttcttggccattgcc
gtggacaacctggctgacgcagagagcctcacctctgcccagaaggaggaggaagaagag
aaggagaggaagaagctggccaggactgccagcccagagaagagacaagaggtggtggag
aagccggccgtggaggagaccaaggaggagaaaatcgagctgaaatccatcactgcggat
ggagagtccccccctgccaccaagatcaacatggacgacctccagcccaacgagaatgag
gacaagagttcctaccccaacctggaaaccacaggagacgaggaggaggagcctgagatg
cccgtgggcccccgtccccgccccctctctgagctgcacctgaaggagaaggcggtgccc
atgccagaagccagcgccttcttcatcttcagcccgagcaacaggttccgcctccagtgc
catcgcatcgtcaacgactccatcttcaccaacctgatcctcttcttcatcctgctcagc
agcatctccctggctgccgaggaccccgtccagcacacctccttcaggaaccacattctg
ttttattttgacattgttttcactaccattttcaccattgaaattgctctgaagatccta
ggcaacgcagactatgtcttcactagtatctttacgttagaaattatcctcaagatgacc
gcctacggggccttcctgcacaagggctccttctgccggaactacttcaacatcctggac
ctactggtggtcagcgtgtccctcatctccttcggcatccagtccagtgccatcaacgtg
gtgaagatcttgcgggtcctgagggtgctgaggcccctgagggccatcaacagggccaag
gggctgaagcacgtggtgcagtgcgtgttcgtggccatccgcaccatcgggaacatcgtg
atcgtcaccacgctgctccagttcatgttcgcctgcatcggggtccagctcttcaagggc
aagctctacacctgttcggacagttccaaacagacagaggccgagtgcaaggggaactac
gtcacctacaaggacggggaggtggatcaccccatcgtccagccccgcagctgggagaac
agcaagttcgacttcgacaacgtcctggcggccatgatggccctgttcaccgtctccacc
tttgaggggtggccagagctgctgtaccgctccatcgactcccacacggaggacaagggc
cccatttacaactaccgcgtggagatctccgtcttcttcatcatttacatcatcatcatc
gccttcttcatgatgaacatcttcgtgggcttcgtcatcgtcaccttccaggagcagggg
gagcaggagtacaagaactgcgagctggacaagaaccagcggcagtgcgtggagtacgcc
ctgaaggcccggcccctgcggaggtacatccccaagaaccagcaccagtacaaggtgtgg
tacgtggtcaactccacctacttcgagtacctgatgttcgtcctcatcctgctgaacacc
atctgcctggccatgcagcactacgggcagagctgcctgttcaaaatcgccatgaacatt
ctcaacatgctgttcaccggcctcttcacggtggagatgatcctgaagctcatcgccttc
aagcccaagggctactttagtgacccctggaatgtctttgactgcctcatcgtaattggc
agcgtaattgacgtcattctcagtgagacgaatcactatttctgtgatgcatggaacaca
tttgacgccttgattgttgttggtagcattgttgacatagccatcaccgaggtaaaccca
gctgaacatacccaatgctctccctttatgaacgcggaggagaactcccgcatctccatc
accttcttccgcctcttccgggtcatgcgtctggtcaagctgctgagccgtggggagggc
atccggacgctgctgtggacgttcatcaagtccttccaggccctgccctacgtcgccctc
ctgatcgtgatgctgttctttatctacgccgtcatcgggatgcaggtgttcgggaaaatc
gccctgaatgacacgacagagatcaacaggaacaacaacttccagaccttcccccaggcc
gtgctgctgcttttcaggtgcgccaccggggaggcgtggcaggacatcatgctggcctgc
atgccgggcaagaagtgcgcccccgagtcggagccgggcagcagcgccgagggggaggcg
ccctgcggcagcagcttcgctgttttctacttcatcagcttctacatgctctgcgccttt
ctgatcatcaacctcttcgtagctgtcatcatggacaacttcgactacctgacaagggac
tggtccattctgggtccccaccacctggacgaattcaagagaatctgggcggagtatgat
cctgaagccaagggtcgcatcaaacacctggatgtggtgaccctgctccggaggattcag
ccccccctgggctttgggaagctgtgccctcaccgcgtggcttgcaaacgcctggtctcc
atgaacatgcccctgaacagcgacgggacggtcatgttcaacgccaccctgtttgccctg
gtccggacggccctgaggatcaaaacggaagggaacctggaacaggccaacgaggagctg
cgggccatcatcaagaagatctggaagcggaccagcatgaagctgctggaccaggtggtg
ccgcctgcgggagatgatgaggtcacggtgggcaagttttacgctactttcctgatccaa
gagtatttccggaaattcaagaagcgcaaagagcagggcctggtgggcaagccctcccag
aggaacgccctgtccctgcaggctggtctgcgcaccctgcatgacctcgggcccgagatc
cgccgggccatctccggggacctgaccgccgaggaggagctggacaaggccatgaaggag
gctgtgtccacggcctcggaagatgacatcttcaggagggccggcggcctgttcggcaac
cacgtgggctactaccccagcgacagccggagcaccttcccccagaccttcaccacccag
cgccctctgcacatcagcaaggcgggcaccagccagggtggcgcggagtcgccctcccac
gagaagctggtggactccaccttcacccccagcagctactcgtccatgggttccaacgcc
aacatcaacaacgccaacaacaccgccctgggccgctgcccctgccctgccggccagccc
ggtgctgtcagcgtcagcaccgtggagggccgtgggccccccttgtcccctgctgtccag
gtgcagggggcctcgtggaggctcagctccaagaggcgcccctcccgggacagcctgata
gccatggtgtgtcaggacgaggcccctcgggatgagacttgtgacctgaggatggatgag
gacgccgagtacggcagcgagcccagcctgatctgcacggagatgctctcctaccaggac
gacgagaatcggcagctggcgccccctgaggaggacaggagagacatccatctctctccg
aagaggggcttcctgcgctccgcctccctaggtcgaagggcctccttccaccttgagtgt
ctgaagcgacagaagaatccagggggagacatctctcagaagacagttctgcccctgcat
ctcgttcaccatcaggcgctggcggtggcgggcctgagccccctcctgcagagaagccat
ccccctggcgccctctccccgccgcatgcaacgccccctgccacgcctggcccggcctgg
cccctgcggcctgtgcccaccttgcggctggagggggctgagtccagtgacaagctcacc
agcagcttcccatccgtccactgcggcccctgggccggggagcccacgccctgtggggcc
agcggcggcatccggagggcccggcccgtgtccctcactgtgcccagcccggcagggccc
cagggccggcccttccacggcagcgccagcagcctggtggaggcggtcttgatctcagaa
ggactggggcagtttgctcaggatcccaggttcctcgaggccaccacccaggagctggcc
gacgcctgcgacatgaccatcgaggagatggagagcgcggccgacaacatccttagcggg
ggcgcccggcagagccccaacggtaccctgctcccgtgtgcaaactgcagggacccaggg
ccagaccgagaggggggcgcggaggacgcggcctgggcgcccagccccgagccccaccag
ggcggagaggagtcccgggacagcagggccttcgccagcagcctgtag

DBGET integrated database retrieval system