KEGG   Delphinapterus leucas (beluga whale): 111176656
Entry
111176656         CDS       T05885                                 

Gene name
TNFRSF1A
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04064  NF-kappa B signaling pathway
dle04071  Sphingolipid signaling pathway
dle04150  mTOR signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04668  TNF signaling pathway
dle04920  Adipocytokine signaling pathway
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle05010  Alzheimer disease
dle05014  Amyotrophic lateral sclerosis
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111176656 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    111176656 (TNFRSF1A)
   04668 TNF signaling pathway
    111176656 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    111176656 (TNFRSF1A)
   04150 mTOR signaling pathway
    111176656 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111176656 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111176656 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111176656 (TNFRSF1A)
   04215 Apoptosis - multiple species
    111176656 (TNFRSF1A)
   04217 Necroptosis
    111176656 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111176656 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111176656 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111176656 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    111176656 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    111176656 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111176656 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111176656 (TNFRSF1A)
   04931 Insulin resistance
    111176656 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111176656 (TNFRSF1A)
   05152 Tuberculosis
    111176656 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111176656 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    111176656 (TNFRSF1A)
   05160 Hepatitis C
    111176656 (TNFRSF1A)
   05171 Coronavirus disease - COVID-19
    111176656 (TNFRSF1A)
   05164 Influenza A
    111176656 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    111176656 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    111176656 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111176656 (TNFRSF1A)
   05165 Human papillomavirus infection
    111176656 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111176656 (TNFRSF1A)
   05142 Chagas disease
    111176656 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111176656 (TNFRSF1A)
   04090 CD molecules [BR:dle04090]
    111176656 (TNFRSF1A)
Cytokine receptors [BR:dle04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111176656 (TNFRSF1A)
CD molecules [BR:dle04090]
 Proteins
  111176656 (TNFRSF1A)
SSDB
Motif
Pfam: TNFR_c6 Death ABATE DUF5315
Other DBs
NCBI-GeneID: 111176656
NCBI-ProteinID: XP_022433073
UniProt: A0A2Y9NUB7
LinkDB
Position
Unknown
AA seq 445 aa
MGLPTVPGLLLPLVLRAVLVDVYPAGIHGLVPHPGDREKRESSCPQGKYSHPQNNSICCT
KCHKGTYLYNDCPGPGLDTDCRVCARGTFTASENHLRQCLSCSKCRKEMFQVEIAPCAVD
QDTVCGCRKNQYRKYWSETLFQCLNCSLCPNGTVHHSCKERQDTVCHCHVGFFLREAECV
SCAHCKNTECEKLCPALPVTSNNSQDPGTTVLLPLVIIFGLCLASFLLIVLACRYQRWKP
KLYSIICGQSAPVKEGEPEPLAPAPSFSPIPSFSPASSPTFTPCDPPWSNFRVTSLPREM
APPHQGAGPILPAPPASTPVPTPVQKWEASAHGAPSAPAPLADADPATLYAVVDGVPPLR
WKEFVRRLGLSDHEIERLELQNLRCLREAQYSMLAAWRRRTPRREATLELLGRVLRDMDL
LGCLEDIEEALGGPARLAPEPRLPR
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgggcctccccaccgtgcctggcctgctgctgccactggtgctccgggctgtgttggtg
gatgtgtaccccgcggggattcatgggctggtccctcaccccggggaccgggagaagaga
gagagttcatgtccccaagggaaatatagccaccctcaaaataattccatttgctgcacg
aagtgccacaaaggtacctacctgtacaatgattgtccgggcccggggctggacacggac
tgcagggtgtgtgcccgcggcacctttaccgcttcggagaaccacctcagacaatgtctg
agctgctccaagtgccggaaagaaatgttccaggtggagattgctccttgcgcagtggac
caggataccgtgtgtggctgcaggaagaaccagtatcggaagtattggagtgaaactctg
ttccagtgtctgaactgcagcctctgccccaacggcacggtgcaccactcctgcaaggag
agacaggacaccgtctgccactgccatgtggggttctttctaagagaagctgagtgcgtc
tcctgtgctcactgtaagaacacggagtgcgagaagttatgtccagctctacctgtaact
agtaacaactctcaggacccaggcactacagtactgttgcccctggtgatcatatttggt
ctttgcctggcatccttcctcctcattgttttagcatgccgataccagcggtggaagccc
aagctctactccatcatttgtgggcagtcggctcctgtaaaggagggggagccagagccc
ctggccccggccccaagcttcagtcccatcccgagcttcagtcctgcctccagtcccacc
ttcaccccctgtgacccgccgtggtccaacttcagagtcacatcactccccagagagatg
gccccgccccaccaaggggctggccccatcctccctgcgcctccagcctccacccccgtc
cccacccctgtgcagaagtgggaggccagcgcccacggcgcccccagcgcccccgctccg
ctcgcagatgctgaccccgcgacactgtacgctgtggtggacggcgtgcccccgttgcgc
tggaaggagttcgtgcggcggctggggctgagtgatcacgaaatcgagcggctggagctg
cagaacttgcgctgcctgcgcgaggcacagtacagcatgctggcggcctggcggcggcgc
accccgcggcgcgaggccacgctggagctgctgggccgcgtgctccgcgacatggacctg
ctcggctgcctggaggacatcgaggaggcgctgggcggccccgcccgcctcgcgcccgag
ccccgccttccccgatga

DBGET integrated database retrieval system