KEGG   Delphinapterus leucas (beluga whale): 111176661
Entry
111176661         CDS       T05885                                 

Gene name
LTBR
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 3
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04064  NF-kappa B signaling pathway
dle04066  HIF-1 signaling pathway
dle04672  Intestinal immune network for IgA production
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111176661 (LTBR)
   04066 HIF-1 signaling pathway
    111176661 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111176661 (LTBR)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111176661 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    111176661 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111176661 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111176661 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111176661 (LTBR)
Cytokine receptors [BR:dle04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111176661 (LTBR)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 111176661
NCBI-ProteinID: XP_022433079
UniProt: A0A2Y9NDQ3
LinkDB
Position
Unknown
AA seq 421 aa
MRLPWAASPCGLAWGPLILGLWGLLAASQPQLVPPYRTENQTCRDRETEYYEPKHHVCCS
RCPPGTHVSAECGPDQDTTCATCPENSYNEHWNHLSICQLCRPCDQMLGFVEITPCTSKH
KTQCRCQPGLFCVFWGSECVHCESLSHCPPGTEAELKDEDRKANSNCVPCKAGHFQNTSS
PSARCQPHTRCEDQGLVEAAPGTSRSDTSCRNPPEPSETPGTMLVLAVLLPLVSLLLLTT
VFACTWKSHPSLCRKLGSLLKRHPEGEESNTAEGSWEPPRVNPQYPDLVEPLLPTSGDST
PASAGLPASPGLEEEALQQQSPLSQARELEAELPEQGQVAHGTNGIHVTGGSVTVTGNIY
IYNGPVLGGARGPGDTPAPPEPPYPIPEEGAPSPPGLSTPYQEDGKAWHLAETETLGCHT
P
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcgcctgccgtgggccgcctccccctgcggcctggcctgggggccgctcatattgggc
ctctggggtctcctggcagcatcccagccccagctggtgcccccctaccgcacggagaac
caaacctgccgggaccgggaaacggagtactacgagcccaagcatcacgtctgctgctcc
cgctgccccccaggcacacacgtctcggctgaatgtggccccgaccaggacaccacttgt
gccacgtgccccgaaaattcctacaacgagcactggaaccatctctccatctgccagctg
tgccgcccctgtgaccagatgctgggcttcgtggagatcacgccttgcactagcaaacac
aaaacccagtgccgctgccagccaggcctcttctgcgtcttttggggctctgagtgtgta
cactgcgagtcactctcccactgcccacctggcactgaagccgagctcaaagatgaagac
aggaaggctaacagcaactgtgttccctgtaaggcagggcacttccagaacacctcctcc
cccagcgcccgctgccagccccacaccaggtgtgaggaccagggcctcgtagaggcggca
ccaggcacctcccggtctgacaccagctgcagaaatccgccagagccctccgagacgcca
ggaacgatgctggtgctggccgtcttgcttccgctggtctccttgctgcttctcaccact
gtgtttgcctgcacctggaagagccacccctctctctgcagaaagctgggatccctgctc
aagaggcacccagagggagaggaatcaaatactgctgaaggaagctgggagcccccgagg
gtcaacccacagtaccctgacctggtagagccacttctgcccacctctggagactcgacc
ccagcttcggccgggctcccggcgtccccaggtttggaggaagaggcgctacaacagcag
agtcctctgagccaggccagggagctggaggctgagctcccagagcaaggccaggtggcc
cacggcaccaatggcattcacgtcaccggcgggtctgtgactgtcaccggcaacatctac
atctacaacgggccagtactggggggagcacggggccccggagacacccccgctcccccg
gagcctccgtaccccatccctgaagagggtgcccctagccctcccgggctctccacaccc
taccaggaggatggcaaagcttggcacctggctgagacagagacactggggtgccacacc
ccctaa

DBGET integrated database retrieval system