KEGG   Delphinapterus leucas (beluga whale): 111176756
Entry
111176756         CDS       T05885                                 

Gene name
GABARAPL1
Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04136  Autophagy - other
dle04137  Mitophagy - animal
dle04140  Autophagy - animal
dle04371  Apelin signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04727  GABAergic synapse
dle05014  Amyotrophic lateral sclerosis
dle05022  Pathways of neurodegeneration - multiple diseases
dle05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111176756 (GABARAPL1)
   04068 FoxO signaling pathway
    111176756 (GABARAPL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111176756 (GABARAPL1)
   04136 Autophagy - other
    111176756 (GABARAPL1)
   04137 Mitophagy - animal
    111176756 (GABARAPL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111176756 (GABARAPL1)
  09156 Nervous system
   04727 GABAergic synapse
    111176756 (GABARAPL1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111176756 (GABARAPL1)
   05022 Pathways of neurodegeneration - multiple diseases
    111176756 (GABARAPL1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111176756 (GABARAPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111176756 (GABARAPL1)
   04121 Ubiquitin system [BR:dle04121]
    111176756 (GABARAPL1)
   03029 Mitochondrial biogenesis [BR:dle03029]
    111176756 (GABARAPL1)
Membrane trafficking [BR:dle04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    111176756 (GABARAPL1)
Ubiquitin system [BR:dle04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   111176756 (GABARAPL1)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    111176756 (GABARAPL1)
SSDB
Motif
Pfam: Atg8 APG12 VitD-bind_III
Other DBs
NCBI-GeneID: 111176756
NCBI-ProteinID: XP_022433265
UniProt: A0A2Y9NGT6
LinkDB
Position
Unknown
AA seq 117 aa
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttccagtataaggaggaccatccctttgagtatcggaaaaaggaaggagaaaag
atccggaagaaatatccggaccgggtccctgtgatcgtggagaaggctcccaaggccagg
gtgcctgatctggacaagaggaagtacctagtgccctctgacctcactgttggccagttc
tacttcttaatccggaagaggatccacctgagacccgaagacgccttattcttctttgtc
aacaacaccatccctcccactagcgcgaccatgggccagctgtatgaggacaaccacgag
gaagactattttctgtacgtggcctacagtgacgagagtgtctacgggaagtga

KEGG   Delphinapterus leucas (beluga whale): 111179501
Entry
111179501         CDS       T05885                                 

Gene name
GABARAPL2
Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 2 isoform X1
  KO
K08341  GABA(A) receptor-associated protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04136  Autophagy - other
dle04137  Mitophagy - animal
dle04140  Autophagy - animal
dle04371  Apelin signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04727  GABAergic synapse
dle05014  Amyotrophic lateral sclerosis
dle05022  Pathways of neurodegeneration - multiple diseases
dle05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111179501 (GABARAPL2)
   04068 FoxO signaling pathway
    111179501 (GABARAPL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111179501 (GABARAPL2)
   04136 Autophagy - other
    111179501 (GABARAPL2)
   04137 Mitophagy - animal
    111179501 (GABARAPL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111179501 (GABARAPL2)
  09156 Nervous system
   04727 GABAergic synapse
    111179501 (GABARAPL2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111179501 (GABARAPL2)
   05022 Pathways of neurodegeneration - multiple diseases
    111179501 (GABARAPL2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111179501 (GABARAPL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111179501 (GABARAPL2)
   04121 Ubiquitin system [BR:dle04121]
    111179501 (GABARAPL2)
   03029 Mitochondrial biogenesis [BR:dle03029]
    111179501 (GABARAPL2)
Membrane trafficking [BR:dle04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    111179501 (GABARAPL2)
Ubiquitin system [BR:dle04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   111179501 (GABARAPL2)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    111179501 (GABARAPL2)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 111179501
NCBI-ProteinID: XP_022438872
UniProt: A0A2Y9P697
LinkDB
Position
Unknown
AA seq 117 aa
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagtggatgttcaaggaggaccactcgctggaacacagatgcgtggaatctgcgaag
atccgagcgaaatatcccgaccgggttccggtgattgtggaaaaagtctcaggctctcag
attgttgacattgacaaacggaagtatctggttccatctgacatcactgtggctcagttc
atgtggatcatcaggaaaaggatccagcttccttctgaaaaggcaatattcctgtttgtg
gataagacagtcccacagtccagcctaactatgggacagctttacgagaaggaaaaagat
gaagatggattcttgtatgtggcctacagtggagaaaacacttttggcttctga

KEGG   Delphinapterus leucas (beluga whale): 111185712
Entry
111185712         CDS       T05885                                 

Gene name
GABARAP
Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04136  Autophagy - other
dle04137  Mitophagy - animal
dle04140  Autophagy - animal
dle04371  Apelin signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04727  GABAergic synapse
dle05014  Amyotrophic lateral sclerosis
dle05022  Pathways of neurodegeneration - multiple diseases
dle05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111185712 (GABARAP)
   04068 FoxO signaling pathway
    111185712 (GABARAP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111185712 (GABARAP)
   04136 Autophagy - other
    111185712 (GABARAP)
   04137 Mitophagy - animal
    111185712 (GABARAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111185712 (GABARAP)
  09156 Nervous system
   04727 GABAergic synapse
    111185712 (GABARAP)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111185712 (GABARAP)
   05022 Pathways of neurodegeneration - multiple diseases
    111185712 (GABARAP)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111185712 (GABARAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111185712 (GABARAP)
   04121 Ubiquitin system [BR:dle04121]
    111185712 (GABARAP)
   03029 Mitochondrial biogenesis [BR:dle03029]
    111185712 (GABARAP)
Membrane trafficking [BR:dle04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    111185712 (GABARAP)
Ubiquitin system [BR:dle04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   111185712 (GABARAP)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    111185712 (GABARAP)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 111185712
NCBI-ProteinID: XP_022451237
UniProt: A0A2Y9Q6V4
LinkDB
Position
Unknown
AA seq 117 aa
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttcgtgtataaagaggagcatccgttcgagaagcgccgctctgagggcgagaag
atccgaaagaaatacccggaccgggtcccggtgatagtagaaaaggctcccaaagctcgg
ataggagacctggacaaaaagaaatatctggtgccttctgatcttacagttggtcagttc
tacttcttgatccggaagcgaattcatctccgagctgaggatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacgatgggtcagctataccaggaacaccatgaa
gaagacttctttctatacattgcctacagtgacgaaagtgtctatggtctgtga

DBGET integrated database retrieval system