KEGG   Delphinapterus leucas (beluga whale): 111176781
Entry
111176781         CDS       T05885                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04151  PI3K-Akt signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04934  Cushing syndrome
dle05162  Measles
dle05165  Human papillomavirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05215  Prostate cancer
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111176781 (CDKN1B)
   04066 HIF-1 signaling pathway
    111176781 (CDKN1B)
   04068 FoxO signaling pathway
    111176781 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    111176781 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111176781 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111176781 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    111176781 (CDKN1B)
   05206 MicroRNAs in cancer
    111176781 (CDKN1B)
   05203 Viral carcinogenesis
    111176781 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    111176781 (CDKN1B)
   05220 Chronic myeloid leukemia
    111176781 (CDKN1B)
   05215 Prostate cancer
    111176781 (CDKN1B)
   05222 Small cell lung cancer
    111176781 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111176781 (CDKN1B)
   04934 Cushing syndrome
    111176781 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    111176781 (CDKN1B)
   05169 Epstein-Barr virus infection
    111176781 (CDKN1B)
   05165 Human papillomavirus infection
    111176781 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111176781 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111176781
NCBI-ProteinID: XP_022433338
UniProt: A0A2Y9NV03
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGAVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGNLPEFYYRPPRPPKGACKVPAQEGQDVSGTRQAVPLIG
SQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaatgggagcccgagcttggagcggatggacgccagacag
gcggagtaccccaagccctcggcctgcagaaacctcttcggcgcggtcaatcacgaagag
ttaacccgggacttggagaagcactgtagagacatggaagaggccagccagcgcaagtgg
aattttgattttcagaatcacaagcccttggagggcaaatacgagtggcaagaggtggaa
aagggcaacttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagggccaggatgtcagcgggacccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacgcatttggtagaccagaagactgatgcaccggacagc
cagacggggttagcggagcagtgcactgggataaggaagcgacctgccacagacgattcc
tctactcaaaacaaaagagcaaacagaacagaagaaaatgtttcagacggttccccgaac
gcgggttcagtggagcagacgcccaagaagccgggcctcagaaggcgtcaaacgtaa

DBGET integrated database retrieval system