KEGG   Delphinapterus leucas (beluga whale): 111176849
Entry
111176849         CDS       T05885                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00220  Arginine biosynthesis
dle00330  Arginine and proline metabolism
dle01100  Metabolic pathways
dle04020  Calcium signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04066  HIF-1 signaling pathway
dle04071  Sphingolipid signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04370  VEGF signaling pathway
dle04371  Apelin signaling pathway
dle04611  Platelet activation
dle04915  Estrogen signaling pathway
dle04921  Oxytocin signaling pathway
dle04926  Relaxin signaling pathway
dle04931  Insulin resistance
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111176849 (NOS3)
   00330 Arginine and proline metabolism
    111176849 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111176849 (NOS3)
   04371 Apelin signaling pathway
    111176849 (NOS3)
   04066 HIF-1 signaling pathway
    111176849 (NOS3)
   04020 Calcium signaling pathway
    111176849 (NOS3)
   04071 Sphingolipid signaling pathway
    111176849 (NOS3)
   04022 cGMP-PKG signaling pathway
    111176849 (NOS3)
   04151 PI3K-Akt signaling pathway
    111176849 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111176849 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    111176849 (NOS3)
   04921 Oxytocin signaling pathway
    111176849 (NOS3)
   04926 Relaxin signaling pathway
    111176849 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111176849 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111176849 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111176849 (NOS3)
Enzymes [BR:dle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     111176849 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15 DEC-1_N
Other DBs
NCBI-GeneID: 111176849
NCBI-ProteinID: XP_022433504
UniProt: A0A2Y9NEZ8
LinkDB
Position
Unknown
AA seq 1205 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCSKQGPASPAPEPSRAPAPAPPPAPDHSPAPNSPQ
LTRPPEGPKFPRVKNWEAGSITYDTLCAQSQQDGPCTPRRCLGSLVFPRKLQSRPSQGPP
PPEQLLSQARGFINQYYSSIKRSGSQAHKERLQEVEAEVAATGTYQLRESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAVTVFPQRAPGR
GDFRIWNSQLVRYAGYRQQDGSVRGDPANVEVTELCIQHGWTPGNGRFDVLPLLLQTPDE
APELFVLPSELVLEVPLEHPTLEWFSALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYM
STEIGMRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIV
DHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQPD
PWKGSTAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYASETGRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
SSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAQA
AAQDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATVLLVENLQSSKSTRAT
ILVRLDTGSQEGLQYQPGDHIGICPPNRPGLVEALMSRVEDPPPPTEPVAVEQLEKGSPG
GPPPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPSEQQELETLSQDPR
RYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVA
VLAYRTQDGLGPLHYGVCSTWLSQLKTGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGI
APFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYREEVQDAQQRGVFGRVLTAFS
REPNSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDME
LDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHMRGAVPWAFDPPGP
DTPGP
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtgggccaggagcccgggccaccctgcggcctggggctaggg
ctgggcctcgggctgtgcagcaaacagggcccggcctccccagcacccgagcccagccgg
gcaccggcacccgcacccccgcccgcgccagaccacagcccggctcccaacagcccccag
ctaacccggcctccagaggggcccaagttccctcgcgtgaagaactgggaggcggggagc
atcacctacgacactctgtgtgcgcagtcacagcaggacgggccctgcacccccagacgc
tgcctgggctccctggtgtttccacggaaactgcagagccgaccctcccagggccctccg
cccccggagcagctgctgagccaggccaggggcttcatcaaccagtactacagctccatc
aagaggagcggctcccaggctcacaaggagcggcttcaggaagtggaagccgaggtggcg
gccacgggcacctaccagcttcgtgagagcgagctggtgttcggggccaagcaggcctgg
cgcaacgccccccgctgcgtgggccggatccagtgggggaagctgcaggtgtttgatgcg
cgggattgcagctctgcacaggagatgttcacctacatctgcaaccacatcaagtacgcc
accaaccggggcaacctccgttcggccgtcacggtgttcccccagcgcgctccgggccgc
ggagacttccgcatctggaacagccagctggtacgctacgcgggctacaggcagcaggac
ggctccgtgaggggggacccggccaacgtggaggtcaccgagctctgcatccagcatggc
tggaccccaggaaacggccgctttgatgtgctacccctgctgctccagaccccagatgag
gctccagaactctttgttctgccctccgaactggtcctcgaggtccccctggagcacccc
acgctggagtggttctcggccctgggcctgcgctggtacgccctcccagcagtgtccaac
atgctgctggaaattgggggcctggagttccctgcagcccccttcagcggctggtacatg
agcacggagattggcatgcggaacctgtgtgatccccaccgctacaacatcctggaggac
gtggccgtctgcatggacctggatacccggaccacctcatccctgtggaaagacaaggca
gccgtggaaatcaacttggctgtgctgcacagttaccagctcgccaaagtgaccattgtg
gaccaccacgctgccacggcctccttcatgaagcacctggagaacgagcagaaggccagg
gggggctgccctgctgactgggcctggatcgtgcccccgatctcgggcagcctcacccca
gtcttccatcaggagatggtcaactatgtcctgtcccctgctttccgctaccagccagac
ccctggaaggggagcacagccaagggcaccggcatcaccaggaagaagacctttaaggaa
gtggccaatgcggtgaagatctctgcctcactcatgggcaccgtgatggcgaagcgagtg
aaggcgacgattctgtacgcctccgagaccggccgggcccagagctacgcacagcaactg
gggaggctcttccggaaggccttcgaccctcgggtcctgtgcatggatgagtatgacgtg
gtgtccctggagcacgagacgctggtgttggtggtgaccagcacctttgggaacggcgat
cccccagagaatggagagagttttgcagcagccctgatggagatgtcgggcccctacaac
agctcccctcggccagagcaacacaagagttacaaaatccgcttcaacagcgtctcctgc
tcagacccgctggtgtcctcctggcggcggaagaggaaggagtccagtaataccgacagc
gcgggggcgctggggaccctcaggttctgtgtgtttgggctgggctcccgggcgtacccc
catttctgcgcctttgctcgtgcggtggacacgcggctggaagagctgggaggggagcgg
ctgcttcagctgggccagggcgatgagctgtgtggccaggaggaggccttccgcggctgg
gcccaggctgccttccaggcctcctgtgagacgttctgcgtgggggaggatgcccaggcc
gcggcccaggacatcttcagccccaaacggagctggaaacgccagaggtaccggctgagc
gcccaggccgagggcctccagctgctgccaggcctgatccacgtgcacaggcggaagatg
ttccaggccacagtcctcttggtggaaaacctgcaaagcagcaagtccacccgggccacg
atcctggtgcgcctggacacgggaagccaggaggggctccagtaccagccgggggaccac
ataggcatctgcccgcccaaccggccggggctcgtggaggcactgatgagccgcgtggag
gacccgccgccgcccaccgagcctgtggcagtggagcagctggagaagggcagcccaggt
ggccctcctcccggctgggtgcgggacccccggctgcccccgtgtacgctgcgccaggct
ctcacctttttcctggacatcacctccccgcccagccctcaacttcttcgactgctcagc
accctggctgaagagcctagtgaacagcaagagctcgagaccctcagccaggacccccgg
cgctacgaggagtggaagtggttccgctgccccaccctgctggaggtgctcgagcagttt
ccatccgtggcactgcctgccccgctgcttctcacccagctgcccctgctccagccccgg
tactactcggtcagctcagcacccagcacccatccaggagagatccacctcacagtagct
gtgctggcatacaggacccaagatgggctgggtcccctgcactatggagtctgctccacg
tggctgagccaactcaagactggagaccccgtaccctgcttcatcaggggggctccctcc
ttccggctgcctcctgatcccagcttgccctgcatcctcgtgggcccgggcactggcatc
gcccccttccggggattttggcaggagcggctacacgacatcgagagcaaagggctgcag
cctgcccccatgaccttggtgttcggctgccggtgctcccagctcgaccatctctaccgc
gaggaggtgcaggatgcccagcagcgcggggtgtttggccgcgtcctcaccgccttctcc
cgggaacccaacagccctaagacctacgtgcaggacatcctgcggacggagctggctgct
gaggtgcaccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcacc
atggcaaccagcgtcctgcagacggtgcagcgcatcttggcgacagagggcgacatggag
ctggatgaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggac
attttcgggctcacgctgcgcacccaggaagtgacaagccgcatacgcacccagagcttt
tccttgcaggagcggcatatgcggggcgcagtgccctgggcgttcgacccgcccggccca
gacacccctggtccctga

DBGET integrated database retrieval system