KEGG   Delphinapterus leucas (beluga whale): 111177070
Entry
111177070         CDS       T05885                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X1
  KO
K08524  retinoid X receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03320  PPAR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04659  Th17 cell differentiation
dle04919  Thyroid hormone signaling pathway
dle04920  Adipocytokine signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle04932  Non-alcoholic fatty liver disease
dle04976  Bile secretion
dle05160  Hepatitis C
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05216  Thyroid cancer
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111177070 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111177070 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111177070 (RXRA)
   03320 PPAR signaling pathway
    111177070 (RXRA)
   04919 Thyroid hormone signaling pathway
    111177070 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    111177070 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    111177070 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177070 (RXRA)
   05202 Transcriptional misregulation in cancer
    111177070 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    111177070 (RXRA)
   05216 Thyroid cancer
    111177070 (RXRA)
   05222 Small cell lung cancer
    111177070 (RXRA)
   05223 Non-small cell lung cancer
    111177070 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111177070 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111177070 (RXRA)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    111177070 (RXRA)
Nuclear receptors [BR:dle03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   111177070 (RXRA)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 111177070
NCBI-ProteinID: XP_022433981
UniProt: A0A2Y9NM79
LinkDB
Position
Unknown
AA seq 495 aa
MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAAPSLHPSLGPGIGSSLGSPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNG
VLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREACGRAARALAAEGLPRELRADWKPPRASAVQE
ERQRGKDRAENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANVGLNPSSPNDPVTN
ICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLA
TGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPA
EVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPI
DTFLMEMLEAPHQMT
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgacttctccacgcaggtgaactcctcttccctc
aactcccccacggggcgcggctccatggccgccccctcgctgcacccctccctggggccc
ggcatcggctcctcgctcggctccccgggacagctgcactcgcccatcagcaccctgagc
tcccccatcaacggcatgggcccgcccttctcggtcatcagctcccccatgggcccccac
tccatgtccgtgcccaccacacccacactgggcttcggcaccggcagcccccagctcaac
tcgcccatgaaccccgtcagcagcagcgaggacatcaagcccccgctgggcctaaacggc
gtcctcaaagtcccggcccacccctcagggaacatggcgtccttcaccaagcacatctgt
gctatctgcggggaccgctcctcaggcaagcactatggggtgtacagctgcgagggctgc
aagggcttcttcaagcggacggtgcgcaaggacctgacctacacctgccgggacaacaaa
gactgcctgattgacaagcggcagcggaaccggtgccagtactgccgctaccagaagtgc
ctggccatgggcatgaaacgcgaagcttgtgggcgcgctgctcgggccctggcggcggag
gggctgccgcgggagctgcgggctgactggaagcctccccgtgcctcagctgtgcaggag
gagcggcagcggggcaaggaccgggctgagaacgaggtggagtccacaagcagcgccaac
gaggacatgcccgtggagaagatcctggaggccgagctggccgtcgaacccaagaccgag
acgtacgtggaggcaaacgtggggctgaaccccagctcgcccaatgaccctgtcaccaac
atctgccaagcggctgacaaacagctcttcaccctggtggagtgggccaagcggatcccg
cacttctccgagctgcccctggacgaccaggtcatcctgctgcgggcaggctggaacgag
ctgctcatcgcctccttctcccaccgctccatagccgtgaaggacggcatcctcctggcc
accgggctgcacgtccaccgcaatagcgcccacagcgcgggggtgggcgccatctttgac
agggtgctgacggagctggtgtccaagatgcgggacatgcagatggacaagacggagctg
ggctgcctgcgcgccatcgtcctcttcaaccccgactccaaggggctctcaaacccggcc
gaggtggaggcgcttcgcgagaaggtctacgcgtccctggaggcgtactgcaaacacaag
taccccgagcagccaggaaggtttgcaaagctgctgcttcgtctgccggccctgcgctcc
atcggcctcaagtgcctggaacacctcttcttcttcaaactcatcggggacacgcccatc
gacaccttcctcatggagatgctggaagccccgcaccaaatgacttag

DBGET integrated database retrieval system