KEGG   Delphinapterus leucas (beluga whale): 111177083
Entry
111177083         CDS       T05885                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04072  Phospholipase D signaling pathway
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111177083 (RALGDS)
   04015 Rap1 signaling pathway
    111177083 (RALGDS)
   04072 Phospholipase D signaling pathway
    111177083 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177083 (RALGDS)
   05231 Choline metabolism in cancer
    111177083 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111177083 (RALGDS)
   05212 Pancreatic cancer
    111177083 (RALGDS)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 111177083
NCBI-ProteinID: XP_022434016
UniProt: A0A2Y9NMB1
LinkDB
Position
Unknown
AA seq 871 aa
MPALSSFTCCPHARDDEQGTGNSSVAQEGTRLNEQKGKEVAVAVAVEDARTCPRPGRLTP
GLEQLLQVPSGHMRSSTQEIGEELVNGVIYSISLRKVQVHHGANKGQRWLGYENDSALNL
YETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQRVLDLLFQSRYGR
CDALTASSRYGCILPYSSEDGGPQDQLKNAVSSILGTWLDQYSEDFCQPPDFPCLKQLVA
YVQLNMPGSDLERRAHLLLAQLERTELTKAEPEALAPALKPTAALEPVPAPALAPRPVPG
PDLEPALGPAPAPAPEPSWPSPVAAENGLGEEKPHLLAFPPDLVAEQFTLMDAELFKKVV
PYHCLGSIWSQRDKRGKEHLAPTVRATVAQFNSVANCVITTCLGDRSVTARARARVLEHW
IEVARECRVLKNFSSLYAILSALQSNSIHRLKKTWEEVSRDSLRIFQKLSEIFSDENNYS
LSRELLIKEGTSKFATLEMNPKRAQRRPKEVLSQGVIQGTVPYLGTFLTDLVMLDTAMKD
YLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSIAAEEHFGAWFRAMERLSEADSYSLSC
ELEPPSESASNTLKVKKSTAIVKRWSDRQAPSTELSTGSSYHSKSCDQLRCGPYLSSGDI
ADALSVHSAGSSSSDVEEITMSFVPESPDGQEKKFWECTSQSSPETSGISSASSSTSSSS
ASTTPVATTRTHKRSVSGVCSYSSSLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQD
KAPAVIRKAMDKHNLDEDEPEDYELVQVISDDRKLKIPDNANVFYAMNSTANYDFVLKKR
TFTKGAKVRHGASSTLPRMKQKGLKIAKGIF
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgccagcactgtcatcattcacatgctgtccccatgcacgtgatgacgaacagggaact
gggaactcctctgttgcccaagaaggcacaagactgaatgagcagaaagggaaggaagtg
gccgtggctgtggctgtcgaggatgcccgcacctgccccagacccgggaggctgactcca
gggctggagcagctgttgcaggtgccgtctgggcacatgaggagctccacgcaggagatt
ggcgaggagctggtcaacggtgtcatctactccatctccctgcgcaaggttcaggtgcac
cacggcgccaacaagggccagcgctggctcgggtatgaaaatgactcggccctgaacctg
tatgagacctgcaaggtgcggaccgtgaaggcaggcacgctggagaagctggtggagcac
ctggtgcccgccttccagggcagcgacctctcctatgtcaccatcttcctgtgcacctac
cgagccttcaccaccacccagcgggtcctggacctgctgttccaaagcaggtacggtaga
tgtgacgccctcacggcctcctctagatacgggtgcatcctcccttattccagcgaggac
ggcggacctcaggaccaactgaaaaatgccgtctcctccatcctgggcacctggctggac
cagtactccgaggacttctgtcagcccccggacttcccgtgcctcaagcagctggtggcc
tacgtgcagctcaacatgcctggctccgacctggagcgccgcgcccaccttctcctggcc
cagctggagcgcacagagctcaccaaggcagagccggaggctctggctccagctctgaag
ccaactgcagccctcgagccagtgccggctccagctctagcacccaggccggtgccaggt
ccagacctcgagccagctctgggaccagcaccagctccagccccagagccttcctggcct
tcgcccgtggctgcagagaacgggttgggtgaggagaagcctcacctcctggcgttcccg
cccgacctggtggcagagcagttcacgctgatggacgcggagctgttcaagaaggtggtg
ccctaccactgcctgggctccatctggtctcagcgggacaagaggggcaaggaacacctg
gctcccaccgtccgtgccaccgtcgcccagttcaacagtgtggccaactgcgtcatcacc
acctgcctcggggaccggagcgtgacggcccgcgccagggcccgggtgttggagcactgg
atcgaggtggcccgggagtgccgggtcctcaagaacttttcgtccctctacgccatcctc
tcggctctgcagagcaactccatccaccggctgaagaagacgtgggaagaagtttccagg
gacagcctccgcatctttcagaagctgtcggagattttctcagatgagaacaactactcc
ctaagcagagagctgctcatcaaggaggggacctccaagtttgccaccctggagatgaac
cccaagagagcccagaggcggccgaaggaggtgttgtcacagggtgtcatccagggcacc
gtcccctacctgggcacgttcctcacagacctggtgatgctggacactgcaatgaaggac
tatctgtatgggagactgatcaacttcgagaagaggaggaaggagttcgaagtgatcgcc
cagatcaagctgctccaatcggcctgcaacaattacagcatcgcagccgaagagcacttt
ggggcctggttccgggctatggagcggctcagcgaggctgacagctactccttgtcgtgt
gagctagagcccccttccgagtcggccagcaacaccctcaaggtcaagaagagcacggcc
atcgtcaagcgctggagcgaccgccaggcccccagcacggagctcagtaccggcagcagc
taccactccaagtcctgtgaccagctcaggtgcggcccctacctcagcagcggggacatt
gccgacgcactgagtgtccactcggccggctcctccagctccgatgtggaggagatcacc
atgagctttgtcccagagtcccctgacggccaggagaagaagttctgggagtgcacctcc
cagtcgtccccagagacctccggcatcagctcggcctccagtagcacctcgtcctcctca
gcctccaccacgcccgtggccaccacgcgcacccacaagcgctccgtgtcaggggtctgc
agctacagctcctccctgcccctctacaaccagcaggtgggcgactgctgcatcatccgg
gtgagcctggacgtggacaacggcaacatgtacaagagcatcctggtgaccagccaagac
aaggctccagctgtaatccgcaaagccatggacaaacacaacctggatgaggatgagcca
gaagactacgagctggtgcaggttatttcggacgatcgaaagctgaagatccctgacaac
gccaacgtgttctacgccatgaactctactgccaactatgactttgtcctaaagaaacgg
accttcaccaagggggcaaaggtcaggcatggagccagctctaccctcccgcgcatgaaa
cagaagggactcaagattgccaagggcatcttctaa

DBGET integrated database retrieval system