KEGG   Delphinapterus leucas (beluga whale): 111177277
Entry
111177277         CDS       T05885                                 

Gene name
TLR4
Definition
(RefSeq) toll-like receptor 4 isoform X1
  KO
K10160  toll-like receptor 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04064  NF-kappa B signaling pathway
dle04066  HIF-1 signaling pathway
dle04145  Phagosome
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle05132  Salmonella infection
dle05133  Pertussis
dle05134  Legionellosis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05205  Proteoglycans in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
dle05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111177277 (TLR4)
   04066 HIF-1 signaling pathway
    111177277 (TLR4)
   04151 PI3K-Akt signaling pathway
    111177277 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111177277 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    111177277 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111177277 (TLR4)
   04620 Toll-like receptor signaling pathway
    111177277 (TLR4)
   04621 NOD-like receptor signaling pathway
    111177277 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111177277 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111177277 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111177277 (TLR4)
   05321 Inflammatory bowel disease
    111177277 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111177277 (TLR4)
   05135 Yersinia infection
    111177277 (TLR4)
   05133 Pertussis
    111177277 (TLR4)
   05134 Legionellosis
    111177277 (TLR4)
   05152 Tuberculosis
    111177277 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111177277 (TLR4)
   05161 Hepatitis B
    111177277 (TLR4)
   05171 Coronavirus disease - COVID-19
    111177277 (TLR4)
   05164 Influenza A
    111177277 (TLR4)
   05162 Measles
    111177277 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111177277 (TLR4)
   05144 Malaria
    111177277 (TLR4)
   05145 Toxoplasmosis
    111177277 (TLR4)
   05140 Leishmaniasis
    111177277 (TLR4)
   05142 Chagas disease
    111177277 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111177277 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:dle04054]
    111177277 (TLR4)
   04090 CD molecules [BR:dle04090]
    111177277 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111177277 (TLR4)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    111177277 (TLR4)
Pattern recognition receptors [BR:dle04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   111177277 (TLR4)
CD molecules [BR:dle04090]
 Proteins
  111177277 (TLR4)
Glycosaminoglycan binding proteins [BR:dle00536]
 Hyaluronan
  Cell surface receptors
   111177277 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_1 DUF1863 LRR_6
Other DBs
NCBI-GeneID: 111177277
NCBI-ProteinID: XP_022434610
UniProt: A0A2Y9NKP1
LinkDB
Position
Unknown
AA seq 841 aa
MMPRTRLAAALILAMAFLFCLRSESWDPCVQVVPNISYQCMELNLYKIPDNIPTSTKILD
LSFNHLNHLNSHSFSNFPELQMLDLSRCEIQMIEDDAYQGLNHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLEDFPIGHLKTLKELNVAHNLIHSFKFPEYFSNLPNLEHL
DLSNNKIQNIYHEDLKVLRQMPLLNLSLDLSLNPLDFIEPGTFKEIKLNELTLRSNFNST
HVMKICIQGLAGLKINRLVLGEFKNERILKSFDTSVLEGLCNLTFEQFRIAYFSKFPRSD
TGLFNCLVNVSAISLLSLNVDSLEALPKDYRWQHLELTNCNFKQFPTLKLNSLKKFVFIG
NKGMSTFIEFELPNLQFLDLKRNHLSFKGCCSRTNFGTTKLKHLDLSFNDVITMNSNFLG
LEQLEHLDFQHSNLKQANDFSVFLSLRNLRYLDISYTNTRVVFHGIFVGLVSLQTLKMAG
NSFQNNLLPDIFTELTNLTILDLSKCQLERVSQMAFHSLPKLQVLNMSHNKLLSLDTLPY
KPLHSLQILDCSFNRIMESKEQELQHLPRSLALLNLTQNDFACVCEHQSFLQWVKDQRQL
LVGAEQMMCTQPLDMQDMPVLSFRNATCQMNKMIISVSVLTILLVSVAGALVYKFYFHLM
LLAGCKKYGRGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKLEKSLL
QQQVELYRLLNRNTYLEWEDSVLGRHIFWRRLRKALLDGKPWKPEGTADADSRQQEATTS
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgatgcctcgcacccgcctggctgcggctctgatcctagccatggccttcctcttctgc
ctgaggtcggagagctgggacccttgtgtacaggtggttcctaacattagttaccaatgc
atggagctgaatctctacaaaatccctgacaacatccccacatcgaccaagatactggac
ctgagctttaaccacctgaatcatttaaacagccatagcttctccaacttcccagaactg
cagatgttggatttatccagatgtgaaattcagatgattgaagatgatgcatatcagggc
ctaaaccacctctccaccttgatattgacaggaaaccctatacagagtttagccctggga
gccttttctgggctatcaagtttacagaagctggtagctgtggagacaaacctagcatct
ctagaggacttccccattgggcatctcaaaaccttgaaggagctcaatgtggctcacaat
cttatccattccttcaagtttcctgaatatttttctaacctgcccaacctggagcacttg
gatctttctaataacaaaatccaaaatatttatcacgaagacttgaaggttctacgtcaa
atgcccctactcaacctctctttagatttgtccctgaaccctttagactttattgaacca
ggcacctttaaagaaattaagctcaatgaactgactttgcgaagtaattttaatagtaca
catgtaatgaaaatttgtattcaaggtctggctggtttaaaaatcaatcggttggttttg
ggagaatttaaaaatgaaaggatcttgaaaagttttgacacatctgtcctggagggactg
tgcaatttgaccttcgaacagtttcggatagcatacttcagtaaattcccaaggagtgat
acaggcttatttaattgtttggtaaatgtttctgcgatttctctgttgagtctgaatgta
gacagtctagaagcccttcctaaggattacagatggcaacacttagaactgactaactgt
aattttaaacaattccccacattgaagctcaattctctcaaaaagtttgttttcataggc
aacaaaggtatgagcacttttattgaatttgagctaccaaaccttcagtttctagatctc
aaaagaaatcacttgagtttcaagggttgctgttctcgcactaattttgggacaaccaaa
ctgaagcatttagatctgagcttcaatgatgtcattactatgaattcaaacttcttgggc
ttagagcaactagaacatctggattttcagcattccaatctgaaacaggccaacgatttt
tcagtattcctatccctcagaaatctccgttaccttgatatttcttataccaacacccga
gttgtcttccatggcatctttgtcggcttggtcagcctccaaaccttgaaaatggcaggc
aattcttttcagaacaacttgcttcctgatatcttcacagaactgactaacttaaccatc
ctggacctctctaagtgtcaactggaacgggtatcccagatggcatttcactccctccct
aaacttcaggtgctaaatatgagtcacaacaaactcttgtcattggatacacttccttat
aaaccactccactccctccagattctggactgcagtttcaaccgtatcatggagtccaag
gagcaagaactacagcatttgccaaggagccttgctttgttaaatcttactcagaatgac
tttgcttgtgtttgtgaacaccagagtttcctgcagtgggtcaaggaccagaggcagctc
ttggtgggagctgagcaaatgatgtgtacacaacctttagatatgcaggacatgcccgtg
cttagtttcaggaatgccacttgtcagatgaacaagatgatcattagtgtgtcggttctc
accatcctcttggtatctgtggcaggagccctggtctataagttctatttccacctaatg
cttcttgctggctgcaaaaagtatggcagaggtgaaagcacctatgatgcttttgtaatc
tactcaagccaggacgaagactgggtgaggaatgaattggtaaagaacttggaggagggg
gtgcccccctttcagctctgccttcactacagagactttattcctggggtagccattgcc
gccaacatcatccaggaaggtttccacaaaagccggaaggttattgtcgtggtgtcccag
cacttcatccagagccgatggtgtatctttgagtatgagattgcccagacctggcagttt
cttagcagccgtgctggcatcatcttcatagtcctgcagaagttggagaagtccctgctg
cagcagcaggtagagctgtatcgccttctcaacaggaatacctacctggagtgggaggac
agtgtcctggggcggcacatcttctggagacgactcagaaaagccttgctggacggtaaa
ccatggaagccagaaggaacagcagatgcagacagcagacagcaggaagcaacaacatcc
acttga

DBGET integrated database retrieval system