KEGG   Delphinapterus leucas (beluga whale): 111177751
Entry
111177751         CDS       T05885                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X1
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04144  Endocytosis
dle04218  Cellular senescence
dle04310  Wnt signaling pathway
dle04350  TGF-beta signaling pathway
dle04371  Apelin signaling pathway
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04659  Th17 cell differentiation
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05220  Chronic myeloid leukemia
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111177751 (SMAD3)
   04350 TGF-beta signaling pathway
    111177751 (SMAD3)
   04390 Hippo signaling pathway
    111177751 (SMAD3)
   04371 Apelin signaling pathway
    111177751 (SMAD3)
   04068 FoxO signaling pathway
    111177751 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111177751 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    111177751 (SMAD3)
   04218 Cellular senescence
    111177751 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111177751 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    111177751 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111177751 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177751 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111177751 (SMAD3)
   05212 Pancreatic cancer
    111177751 (SMAD3)
   05225 Hepatocellular carcinoma
    111177751 (SMAD3)
   05226 Gastric cancer
    111177751 (SMAD3)
   05220 Chronic myeloid leukemia
    111177751 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111177751 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111177751 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111177751 (SMAD3)
   05161 Hepatitis B
    111177751 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 111177751
NCBI-ProteinID: XP_022435567
UniProt: A0A2Y9NWL7
LinkDB
Position
Unknown
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggctgcaggtgtcccaccgg
aaggggctcccccatgtcatctactgccgtctgtggcgatggcccgacctacacagccac
catgagctgcgggccatggagctgtgtgagttcgccttcaacatgaagaaggacgaggtc
tgcgtgaatccctaccactatcagagggtggagaccccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccgctggacgactacagccattccatc
cccgaaaacactaacttccctgccggcatcgagccccagagcaatattccagaaacccca
cccccaggctacttgagtgaagatggagagaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacacaataacttggac
ctgcagcccgtcacctactgcgagccggccttctggtgttccatctcctactacgagctc
aaccagcgtgttggggagacattccacgcctcacagccgtccatgacagtggatggcttc
accgatccctccaactcagagcgcttctgcctggggctgctctccaatgtcaacaggaac
gcggccgtggagctgacgcggaggcatatcgggcgaggcgtgcggctgtactacatcgga
ggcgaggtcttcgcagagtgcctcagcgacagtgccatctttgtccagtctcccaactgt
aaccagcgctacggctggcacccagccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagtttgccgccctcctggctcaatctgtcaaccagggcttc
gaggccgtgtaccagctgacccggatgtgcaccatccgcatgagcttcgtcaagggctgg
ggagccgagtacaggagacagaccgtgaccagcaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccgagcatccgc
tgctccagtgtgtcttag

KEGG   Delphinapterus leucas (beluga whale): 111180276
Entry
111180276         CDS       T05885                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04144  Endocytosis
dle04218  Cellular senescence
dle04350  TGF-beta signaling pathway
dle04371  Apelin signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04659  Th17 cell differentiation
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05142  Chagas disease
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111180276 (SMAD2)
   04390 Hippo signaling pathway
    111180276 (SMAD2)
   04371 Apelin signaling pathway
    111180276 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111180276 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    111180276 (SMAD2)
   04218 Cellular senescence
    111180276 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111180276 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111180276 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111180276 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180276 (SMAD2)
   05205 Proteoglycans in cancer
    111180276 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111180276 (SMAD2)
   05212 Pancreatic cancer
    111180276 (SMAD2)
   05225 Hepatocellular carcinoma
    111180276 (SMAD2)
   05226 Gastric cancer
    111180276 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111180276 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111180276 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111180276 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111180276 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 111180276
NCBI-ProteinID: XP_022440234
UniProt: A0A2Y9NZF1
LinkDB
Position
Unknown
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccagttgtgaagagactgctgggatggaagaaa
tcagcgggtggatctggaggagcaggtggtggagagcagaatggacaggaagaaaagtgg
tgtgagaaagcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtcttcaggtatctcatcgg
aaaggactgccgcatgtaatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaggcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttttgcctccggtgttagtg
ccacggcatactgagatcttaacagaactaccacctctggatgattatacccactccatt
ccagaaaacactaatttcccagcgggaattgagccacagagtaattatatcccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgatcaacagttgaaccaaagt
atggatacaggatctccagcagaactatctcctactactctttcccctgttaatcatagt
ttggatttgcagcctgttacttactcagaacctgcattttggtgttcaatagcgtattac
gaattaaaccagagggttggagagaccttccatgcatcacagccctcactcaccgtagac
ggcttcacagatccatcaaattcagagaggttctgcctaggtttactctctaacgtcaac
agaaatgctacagtagaaatgacaagaagacatataggaagaggagtgcgcttatattac
ataggtggagaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatacggctggcaccctgcaacagtgtgtaaaattccaccaggctgt
aacctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtccgttaatcag
ggttttgaagccgtgtatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacagtaacaagcactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system