KEGG   Delphinapterus leucas (beluga whale): 111177863
Entry
111177863         CDS       T05885                                 

Gene name
NRG4
Definition
(RefSeq) pro-neuregulin-4, membrane-bound isoform
  KO
K05458  neuregulin 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111177863 (NRG4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111177863 (NRG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111177863 (NRG4)
Cytokines and growth factors [BR:dle04052]
 Growth factors
  Growth factors (RTK binding)
   111177863 (NRG4)
SSDB
Motif
Pfam: EGF EGF_2 Laminin_EGF
Other DBs
NCBI-GeneID: 111177863
NCBI-ProteinID: XP_022435845
UniProt: A0A2Y9NSD7
LinkDB
Position
Unknown
AA seq 116 aa
MPTDHEEPCGPSHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTKSD
LFAAFVALAVLLGTLIIGALYFLCRKGHLQRASSIQYDISLVETSSTSVHHSHGEH
NT seq 351 nt   +upstreamnt  +downstreamnt
atgccaacagatcatgaagagccctgtggtcccagtcataggtcattttgcctgaatgga
gggatttgttatgtgatacctactattcccagcccattttgtagatgcattgaaaattat
acaggagctcgttgtgaagaggtttttctcccaagctccagcatccaaactaaaagtgac
ctgtttgcagcttttgtggcattggctgttcttctaggaactcttatcattggagccctc
tacttcctttgcaggaagggccaccttcagagggccagttcgatccagtatgacatcagc
ctggtagagacaagcagtaccagtgtccaccacagtcatggagaacattga

DBGET integrated database retrieval system