KEGG   Delphinapterus leucas (beluga whale): 111178037
Entry
111178037         CDS       T05885                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1
  KO
K05719  integrin beta 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04015  Rap1 signaling pathway
dle04145  Phagosome
dle04151  PI3K-Akt signaling pathway
dle04360  Axon guidance
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04514  Cell adhesion molecules
dle04530  Tight junction
dle04611  Platelet activation
dle04670  Leukocyte transendothelial migration
dle04810  Regulation of actin cytoskeleton
dle05100  Bacterial invasion of epithelial cells
dle05133  Pertussis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05145  Toxoplasmosis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05222  Small cell lung cancer
dle05410  Hypertrophic cardiomyopathy
dle05412  Arrhythmogenic right ventricular cardiomyopathy
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111178037 (ITGB1)
   04151 PI3K-Akt signaling pathway
    111178037 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111178037 (ITGB1)
   04514 Cell adhesion molecules
    111178037 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111178037 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111178037 (ITGB1)
   04530 Tight junction
    111178037 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111178037 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111178037 (ITGB1)
   04670 Leukocyte transendothelial migration
    111178037 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    111178037 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178037 (ITGB1)
   05205 Proteoglycans in cancer
    111178037 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111178037 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111178037 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111178037 (ITGB1)
   05414 Dilated cardiomyopathy
    111178037 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111178037 (ITGB1)
   05133 Pertussis
    111178037 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    111178037 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111178037 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111178037 (ITGB1)
   05140 Leishmaniasis
    111178037 (ITGB1)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    111178037 (ITGB1)
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111178037 (ITGB1)
Cell adhesion molecules [BR:dle04515]
 Integrins
  Integrin beta subunits
   111178037 (ITGB1)
CD molecules [BR:dle04090]
 Proteins
  111178037 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 111178037
NCBI-ProteinID: XP_022436157
UniProt: A0A2Y9NYK1
LinkDB
Position
Unknown
AA seq 798 aa
MNLQLIFWIGLISSVCYVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCHPDDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISVTSNKCPNKNSETIKIKPLGFTEEVEIILQFICECECQSEGIPGSPKCHDG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSCT
AVNGQICNGRGVCECGACKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNITKVENRDRLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEATVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggattggattgatcagttcagtttgctatgtgtttggc
caagcagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagagtgtatacaa
gcagggccaaattgtgggtggtgcaccaattcaacatttttacaagaaggaatgcctact
tctgctcgatgtgatgatttagaagccttaaagaagaagggctgtcatccagatgacatt
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtcaccaaccgtagcaaa
ggaacagcagagaagctgcagccagaagatattactcagatccaaccacagcagttggtt
ttgcagttacgatcaggggagccacagacatttacattaaaattcaagcgagctgaagac
tatcccatcgatctctactaccttatggacctctcctactctatgaaagacgacttggag
aatgtgaaaagtcttggcactgatttgatgaatgaaatgaggaggattacttcagacttc
cgaattgggtttggctcatttgtggagaaaaccgtgatgccttacattagcacaacacca
gctaaactcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctataaa
aatgtgctcagccttactgataaaggggaggtatttaatgaacttgttggtaaacagcgc
atatctggaaatttggattctccagaaggtggctttgatgcaatcatgcaagttgcagtt
tgtggatcattgattggctggaggaatgtgacacggctgctggtgttttccacggatgct
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacag
tgtcacctggaaaatgatgtgtacacaatgagccattattacgattatccttctattgct
caccttgtccaaaaactaagtgaaaataacattcagacgatttttgcagttactgaagaa
tttcagcccgtttacaaggaactgaaaaatttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaatccagttgatcatcgatgcatacaattccttgtcttca
gaagtcattttggaaaacagcaaattaccagaaggagtaacaataaattacaagtcttac
tgcaagaatggagtgaatggaacaggggaaaatgggagaaaatgctctaatatttccatt
ggggatgaggttcagtttgaaatcagcgtaacttcaaataaatgtccaaataagaattct
gaaaccattaaaattaagcctctgggcttcactgaagaagtagagattattcttcagttc
atctgtgaatgtgaatgccagagtgaaggcatccctggcagtcccaagtgccatgatggc
aatgggacctttgagtgtggagcctgcaggtgcaacgagggacgtgttgggagacattgt
gaatgtagcacagatgaggtgaacagtgaagatatggacgcttactgcaggaaagagaac
agttcagagatatgtagcaacaatggagaatgtgtctgtggacagtgtgtgtgtcggaag
agggataatacaaacgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtctgcaagtgtcgtgtgtgtgaa
tgcaaccctaactacactggcagtgcctgtgactgttctctggacactacctcctgcacg
gctgtgaatgggcagatctgcaatggccggggcgtctgtgagtgtggcgcctgtaagtgt
acagatcccaagttccaagggccgacctgtgagatgtgccagacgtgccttggagtctgt
gccgagcataaggaatgtgttcagtgccgagccttcaacaaaggagaaaagaaagacacg
tgtgctcaggaatgttcacatttcaacattaccaaggttgaaaatcgggacaggttgccc
cagccaggccaggtggatcccctgtcccattgtaaggagaaggacgttgacgattgctgg
ttctacttcacatattcagtgaatgggaacaatgaggccactgttcatgttgtagagact
ccagagtgccccactggtccagacattatcccaattgtagcaggtgtggttgctggaatt
gttcttattggccttgcattgctgctgatttggaagcttttaatgatcattcatgacaga
agggaatttgccaaatttgaaaaggaaaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgctgtgacaactgttgtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system