KEGG   Delphinapterus leucas (beluga whale): 111178052
Entry
111178052         CDS       T05885                                 

Gene name
BMI1
Definition
(RefSeq) polycomb complex protein BMI-1
  KO
K11459  polycomb group RING finger protein 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle05202  Transcriptional misregulation in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111178052 (BMI1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111178052 (BMI1)
   05206 MicroRNAs in cancer
    111178052 (BMI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111178052 (BMI1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     111178052 (BMI1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 zf-RING_UBOX Prok-RING_4 zf-C3HC4_4 zf-RING_10 zf-Nse
Other DBs
NCBI-GeneID: 111178052
NCBI-ProteinID: XP_022436187
UniProt: A0A2Y9NM47
LinkDB
Position
Unknown
AA seq 326 aa
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPGTPVQSPHPQFPHISSTMNGTSSSP
SGNHQSSFANRPRKSSVNGSSATSSG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgcatcgaacaaccagaatcaagatcactgagctaaatccccacctaatgtgtgtgctt
tgtggagggtacttcattgatgccacaaccataatagaatgtctacattccttctgtaaa
acgtgtattgtgcgttacctggagaccagcaagtattgtcctatctgtgatgtccaagtt
cacaagaccagaccactactgaatataaggtcagataaaactcttcaagatattgtatac
aaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttttatgcagct
catccttcagctgatgctgccaatggctctaatgaagatagaggagaagttgcagatgaa
gataagagaattataactgatgatgaaataataagtttatccattgaattctttgaccag
aacagattggatcggaaagtaaataaagacaaggagaaatctaaggaggaggtgaatgat
aaaaggtatttacgatgcccagcagcaatgactgtgatgcacctaagaaagtttctcaga
agtaaaatggacatacctaatactttccagattgatgtcatgtatgaagaggaaccttta
aaggattactatacactaatggacattgcctacatttatacctggagaaggaatggtccg
cttcctttgaaatacagagttcgacctacttgtaaaagaatgaagatcagtcatcagaga
gatggactgacaaacgctggagaactggaaagtgactctgggagtgacaaggccaacagc
ccagcaggaggtattccctccacctcttcttgtttgcccagccccggcactccagtccag
tctcctcatcctcagtttcctcacatttccagcactatgaatggaaccagcagcagcccc
agcggtaaccaccaatcttcttttgccaatagacctcgaaaatcgtcagtaaatgggtcg
tcagcaacttcatctggttga

DBGET integrated database retrieval system