KEGG   Delphinapterus leucas (beluga whale): 111178108
Entry
111178108         CDS       T05885                                 

Gene name
VIM
Definition
(RefSeq) vimentin
  KO
K07606  vimentin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05169  Epstein-Barr virus infection
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111178108 (VIM)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111178108 (VIM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111178108 (VIM)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111178108 (VIM)
   04147 Exosome [BR:dle04147]
    111178108 (VIM)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     111178108 (VIM)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     111178108 (VIM)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111178108 (VIM)
  Exosomal proteins of other cancer cells
   111178108 (VIM)
SSDB
Motif
Pfam: Filament Filament_head DUF4515 DUF1664 HALZ TPR_MLP1_2 DUF573 CENP-F_leu_zip Laminin_II Jnk-SapK_ap_N Golgin_A5 Baculo_PEP_C GAS
Other DBs
NCBI-GeneID: 111178108
NCBI-ProteinID: XP_022436316
UniProt: A0A2Y9NTL3
LinkDB
Position
Unknown
AA seq 466 aa
MSSRSVSSSSYRRMFGGPGTASRPSSSRSYVTTATRTYNLGSALRPGTSRSLYASSPGGV
YATRSAAMRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDK
VRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLSE
DIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDE
EIQELQAQIQEQHVQIDMDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSE
AANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQD
TIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIALPLPNFSS
LNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgtccagcaggtccgtgtcctcgtcctcctaccgcaggatgttcggcggccccggcacc
gcgagccggccgagctccagccggagctacgtgaccacggccacccgcacctacaacctg
ggcagcgcgctgcgccccggcaccagccgcagcctctacgcctcgtccccgggcggcgtg
tacgccacgcgctccgcggccatgcgcctgcggagcagcgtgcccggcgtgcgcctgctg
caggactcggtggacttctcgctggccgacgccatcaacaccgagttcaagaacacccgc
accaacgagaaggtggagctgcaggagctgaacgaccgcttcgccaactacatcgacaag
gtgcgcttcctggagcagcagaacaagatcctgctggccgagctcgagcagctcaagggc
cagggcaagtcgcgcttgggggacctctacgaggaggagatgcgagagctgcgccggcag
gtggaccagctcaccaacgacaaagcccgcgtcgaggtggagcgcgacaacctgtccgag
gacatcatgcgtctccgggagaagttgcaggaggagatgcttcagagggaggaagccgag
agcaccctgcagtctttcagacaggatgttgacaatgcttcattggcacgtctggacctg
gagcgtaaagtggaatccttgcaagaagagattgcctttttgaagaaactacatgatgag
gaaatccaggagctgcaggcccagattcaagaacagcacgtccagatcgatatggatgtt
tccaagcccgacctcacggctgccctgcgtgacgtccgccagcagtacgagagcgtggcc
gccaagaacctccaggaggctgaggaatggtacaagtccaagttcgctgacctctccgag
gctgctaaccgcaacaacgatgccctgcgccaggccaagcaggagtcgaacgagtaccgt
cggcaggtgcagtccctcacctgcgaggtggatgccctcaaaggcaccaacgagtctctg
gaacgccagatgcgtgaaatggaagagaactttgccgtggaagctgctaactaccaagac
actattggccgcctgcaggacgagattcagaacatgaaggaagagatggctcgtcacctg
cgtgaataccaagatctgttgaatgttaagatggctctcgacatcgagattgccacctac
aggaagctgctggaaggagaggagagcaggattgctctgcctcttccaaacttttcttcc
ctgaacctgagggaaaccaatctggattcactccctctggttgacacccattcaaaaagg
acacttctgattaagacggttgaaaccagagatggacaggttatcaacgaaacttcccag
catcacgatgatctggaataa

DBGET integrated database retrieval system