KEGG   Delphinapterus leucas (beluga whale): 111178123
Entry
111178123         CDS       T05885                                 

Gene name
ZEB1
Definition
(RefSeq) zinc finger E-box-binding homeobox 1 isoform X1
  KO
K09299  zinc finger homeobox protein 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05202  Transcriptional misregulation in cancer
dle05206  MicroRNAs in cancer
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111178123 (ZEB1)
   05206 MicroRNAs in cancer
    111178123 (ZEB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    111178123 (ZEB1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    111178123 (ZEB1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-Di19 zf-C2H2_jaz Homeodomain zf-C2H2_6 zf-C2HE zf-C2H2_2 zinc_ribbon_15
Other DBs
NCBI-GeneID: 111178123
NCBI-ProteinID: XP_022436349
UniProt: A0A2Y9NMM0
LinkDB
Position
Unknown
AA seq 1031 aa
MLCSLILAGKEGQEILGPEARADEVGGTVKDDECDSDAENEQNHDPNVEEFLQQQDTAVI
YPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNED
NFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGGNRKFKCTECGKAFKYKHHLKEH
LRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVNGRPRTGLKTSQCPSPSLSA
SPGSPTRPQVRQKIENKPFQEQLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSGG
GPLQATSTPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLAS
KEQETISASSIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPV
PTNSCKSEKLPEDLTVKSEKDKSFEGGNDSTCLLCDDCPGDISALPELKHYDLKQPAQPR
LPPTPEGAKPEASAPSGSGDGSLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVN
LPPDVVKKWFEKMQTGQTSLQSSEASSPEPGKANIPAKNDDQPQPTNADESQDGTRNLQS
PLKITSSPVLPVGSAVNGSRSSASSPSPLNLSSSGNAQGYSYPSEGAQEEPQVEPLDLSL
PKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTDSEPVVNVIPPSANP
INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTLLIPQVAYTYSTAVSPAAQEAALR
AAQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSL
LRHKYEHTGKRPHECGICKKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRFSHSGSYSQHM
NHRYSYCKREAEGPEPGAAGPGGPPAHHAGARASPSQGDSDERESSTREEDEDSDKEEEE
EEREMEDLQEEKESGGPQGGEGREGEGREGEGRANSEGAREGAGAGSPAHSLEHKVSQGA
EQVSEEKTNEA
NT seq 3096 nt   +upstreamnt  +downstreamnt
atgctttgttctttgattttagcaggaaaggaaggacaagaaatcctggggcctgaagct
cgggcagatgaagtgggaggtacagtaaaagatgatgaatgcgactcagatgcagaaaat
gaacaaaaccatgatcctaacgttgaagagttcctgcagcaacaagacactgcagtcatc
taccccgaggcgcccgaggaggaccagaggcagggcacgccggaggccagcgggcacgat
gaaaacggaacaccagatgcattttcccagttacttacctgcccatattgtgacagagga
tataaacgctttacctctctgaaagaacacattaaataccgccatgaaaagaacgaagac
aacttcagttgctccctgtgcagttacacctttgcgtacagaacccagctcgaacgtcac
atgacctcccataaatcaggaagagatcaaagacatgtgacgcagtctgggggtaatcgt
aaattcaagtgcactgaatgtggaaaagctttcaaatacaaacaccatctaaaagagcac
ttaagaatccacagtggagagaagccatatgaatgcccaaactgcaagaaacgtttttcc
cattccggttcctatagctcacacataagcagtaagaaatgtatcagcctgatgcctgtg
aacgggcgaccacgaacagggctcaagacctcgcagtgtccctcaccatctctctcggca
tcaccaggcagtcccacgcgaccacaggtacggcagaagatagagaataagcccttccaa
gaacaactttccgtaaaccaaatcaaaactgagcctgtggactatgagttcaagcccata
gtggttgcttcaggaatcaactgttcaacccctttacagaatggggttttcagtggtggt
ggccccttacaggcaaccagtactcctcagggtgtggtgcaagccgttgttctgccaacg
gtggggttggtgtcccccatcagtatcaatttaagtgatattcagaatgtacttaaagtg
gcagtagatggtaatgtaatcaggcaagttttggagaataatcaagccaatcttgcatcc
aaagaacaagaaacaatcagcgcttcatccatccagcaaggtggccattctgttatttca
gccatcagtcttcctctggttgatcaagatggaacaaccaaaatcatcattaactacagt
cttgaacaacctagccaacttcaagttgttcctcagaatttaaaaaaagaaaatccagtc
cccaccaacagttgcaaaagtgaaaagttaccagaagatcttactgttaaatctgagaag
gacaaaagctttgaaggagggaatgacagcacttgcctcctgtgtgacgactgtccaggg
gacatcagcgcacttccggagctaaagcactatgacctgaagcagcccgcccagccccgt
ctgccccccaccccagaaggtgccaagcccgaggcctctgctccctcggggtccggagac
ggcagtctgtctcccagccagccacctttaaagaacctcctgtctcttctgaaagcatat
tatgctttgaatgcacagccaagtgcagaagagctctcaaaaattgctgactcagtgaac
ctaccgccggatgtagtgaaaaagtggtttgaaaagatgcagacaggacagacttcattg
cagtcttctgaagcatcttctcccgagccaggcaaagccaacatcccagctaagaacgat
gatcagcctcagcccacaaacgcagatgaatcccaggacggcacaaggaatctccagagt
cctctgaagataactagctcccccgtcctaccagtgggctccgcggtcaatggttccaga
agcagtgcatcatccccatcccccctcaacctctcctcctccggaaacgcacagggttac
tcgtacccgtcagaaggggcacaggaagagccacaagtcgaacctcttgatctttcacta
ccaaagcaacagggagagttattggaaaggtcaactatcactagtgtttaccagaacagt
gtttattctgtccaggaagaacccttgaacttgtcttgtgcaaaaaaggagccacaaaag
gacagttgtgtcacagactcagaaccagttgtaaatgtaatcccaccaagtgccaacccc
ataaatattgctatacctacagtcactgcccagttacccacgatcgtggccatcgccgac
cagaacagcgttccgtgcttgcgagcgctggcggccaacaagcagaccctgctgatcccc
caggtcgcctacacgtactcgactgcagtcagcccggcggcccaggaagcagccctgagg
gcggcccagcccaacggaaatcaggatgaaaggcaagacactagctcagaaggagtatca
aatgtagaggatcagaatgactctgattccacgccacccaaaaagaaaatgcgaaagaca
gaaaatgggatgtatgcttgtgatttgtgtgataagatattccagaagagtagctcgttg
ttgagacataaatacgaacacacaggtaaaagacctcacgagtgcggcatctgcaaaaag
gcgtttaaacacaagcaccacctgatcgagcacacacgcttgcattccggggagaagccc
taccagtgcgacaagtgcgggaagcgcttctcccactcgggctcctattcccagcacatg
aaccaccgctactcctactgcaagagggaggccgaggggcccgagccgggggccgcgggc
ccagggggcccgcccgcgcaccacgcgggggcccgcgcctccccctcgcagggcgactct
gacgagagggagagctccacgcgggaggaggacgaggacagtgacaaggaggaggaggag
gaggagagggagatggaagacctgcaggaggaaaaggaaagtggaggaccgcaggggggg
gaggggcgcgagggggaggggcgcgagggggaggggcgagccaactccgaaggtgcgagg
gagggcgcaggagctggaagcccagcccacagtttagaacacaaagtcagccagggcgct
gagcaggtgtctgaagagaaaacaaatgaagcctga

DBGET integrated database retrieval system