KEGG   Delphinapterus leucas (beluga whale): 111178461
Entry
111178461         CDS       T05885                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04621  NOD-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05140  Leishmaniasis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05212  Pancreatic cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111178461 (JAK1)
   04151 PI3K-Akt signaling pathway
    111178461 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111178461 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111178461 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111178461 (JAK1)
   04658 Th1 and Th2 cell differentiation
    111178461 (JAK1)
   04659 Th17 cell differentiation
    111178461 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111178461 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178461 (JAK1)
   05203 Viral carcinogenesis
    111178461 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111178461 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111178461 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111178461 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111178461 (JAK1)
   05161 Hepatitis B
    111178461 (JAK1)
   05160 Hepatitis C
    111178461 (JAK1)
   05171 Coronavirus disease - COVID-19
    111178461 (JAK1)
   05164 Influenza A
    111178461 (JAK1)
   05162 Measles
    111178461 (JAK1)
   05168 Herpes simplex virus 1 infection
    111178461 (JAK1)
   05163 Human cytomegalovirus infection
    111178461 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111178461 (JAK1)
   05169 Epstein-Barr virus infection
    111178461 (JAK1)
   05165 Human papillomavirus infection
    111178461 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111178461 (JAK1)
   05140 Leishmaniasis
    111178461 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111178461 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111178461 (JAK1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111178461 (JAK1)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111178461 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 RIO1 SH2
Other DBs
NCBI-GeneID: 111178461
NCBI-ProteinID: XP_022436928
UniProt: A0A2Y9P436
LinkDB
Position
Unknown
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSSKKTDANLEAPEPGVEVLFYLSDREPLRLGGGEYTAEEL
CIKAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNSYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
RFHPNDNGNILCYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLDNKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLCSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSELLGVQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIMQGEHLGRGTRTHIYSGT
LMDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGTDSECGPFIKLSDPGIPVTVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPEEVYQLMRKCWEFQPSIRTT
FQNLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatttaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgacgcgaatctggaggcccctgagccaggggtggaagtgctcttc
tatctgtcggacagggagcccctccggttgggcggcggagagtacacagcggaggagctg
tgcatcaaggcggcgcaggaatgctgtatatctcctctgtgtcacaacctctttgccctg
tatgatgagaacaccaagctctggtatgctccgaatcgcaccatcaccgtcgacgacaag
atgtcactccggctccactaccggatgaggttctatttcaccaactggcacgggaccaat
gataacgagcagtcagtatggcgacattctccaaagaagcagaagaatagctacgagaaa
aaaaaagttccagatgcaacccctctccttgacgccagctcattggagtatctgtttgct
cagggacagtatgatttggtcaaatgcctggctcccattcgagaccccaagacggagcag
gatgggcatgatattgagaacgagtgtctgggaatggccgtcctggccatctcccactat
gccatgatgaagaagatgcagttgccagaacttcccaaggacatcagctacaagcgatat
ataccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggagtttaacaacaagaccatttgtgacagcagt
gtgtccacacatgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccatgctactgatttcatcagaaaatgagatgaat
cggttccatccgaatgataatggaaacattctctgctatgaagtgatggtgactggaaat
cttggaatccagtggaggcagaaaccaaatgttgttcctgttgaaaaggaaaaaaataaa
ctgaaacggaaaaaactggacaataaacacaagaaggatgaggagaaaaataaaatccgg
gaagagtggaacaatttttcttacttccctgagatcactcacattgtaatcaaggagtct
gtggtcagcattaataagcaggacaacaaaaaaatggaactgaagctctgttcccacgag
gaggccttgtcctttgtgtccctcgtggacggctacttccggctcacagcagatgcccat
cattacctctgcaccgacgtggctcccccgttgatcgtccacaacatacagaatggctgt
cacggtccaatctgcacagaatatgccatcaataagttgcggcaagaaggaagcgaggag
ggaatgtacgtgctgcggtggagctgcaccgacttcgacaacatcctcatgaccgtcact
tgctttgaaaagtctgagttgctgggtgtccagaagcagttcaagaactttcagattgag
gtgcagaagggccgctacagcctgcatggctcagaccgaagcttccccagccttggagac
ctcatgagccacctgaagaagcagatcctgcgcacggacaacatcagctttgtgctgaag
cgctgctgccagcccaagccccgagaaatctccaatctgctggtggccaccaagaaagcc
caggagtggcagcctgtctaccccatgagccagctgagttttgatcggatcctcaagaaa
gatattatgcagggcgagcaccttgggagaggcacgcggacacacatctactctgggacc
ctcatggattacaaggatgacgaaggaacttccgaagagaagagaataaaagtgatcctc
aaagtcttagaccccagccacagggacatttctctggccttctttgaggcagccagcatg
atgagacaggtctcccataaacacatcgtgtacctctatggcgtttgtgtccgagacgtg
gagaatatcatggtggaagagtttgtggagggagggcccctggatctcttcatgcaccgg
aaaagtgatgtcctcaccacaccctggaagttcaaagttgccaaacagctggccagcgcc
ctgagttacttggaggataaagatctggtccacggaaatgtgtgcactaaaaacctcctc
ctggcccgcgagggcactgacagcgagtgcggccccttcatcaagctcagtgaccccggc
atccccgtcactgtgctgtccaggcaagagtgcatagaacgaatcccatggatcgctcct
gagtgtgttgaagactccaagaacctgagtgtggccgctgacaagtggagctttggaacc
acgctctgggagatctgctacaatggcgagatccccttgaaagacaagacactgattgag
aaagagaggttctatgaaagccggtgcaggccagtgaccccgtcttgtaaggagctagct
gaccttatgacccgctgcatgaactacgaccccaaccagagacccttcttccgagccatc
atgagagacatcaataagctggaggagcagaatccagacatcgtatcagaaaaaaagcca
gcaactgaagtggatcccacacattttgaaaagcggttcttaaagaggatccgtgacttg
ggagagggccactttgggaaggtcgagctctgcaggtatgaccctgagggggacaataca
ggggagcaggtggccgtcaaatccctgaagcctgagagcggagggaaccacatagctgat
ctgaagaaggaaattgaaatcttaagaaacctttatcatgagaacattgtgaagtataaa
ggcatctgcacagaagacggaggaaacggtattaagctcatcatggaatttctgccttca
ggaagtcttaaggagtatcttccaaagaataagaacaaaattaacctcaaacagcagtta
aaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatacgttcac
cgtgacttagcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattggggac
tttggtctaaccaaagccattgaaactgataaggagtactacacagtcaaggacgatcgg
gacagccctgtgttttggtatgctccagaatgtttaattcagtgtaagttttatatcgcc
tctgatgtctggtcttttggagtaactctgcatgagctgcttacttactgtgattcagat
tccagtcccatggcgttgttcctgaaaatgataggcccaactcatggccagatgacagta
acaagacttgtgaatacattaaaagaaggaaaacgtttgccttgtccacctaactgtcca
gaagaggtttatcaacttatgagaaaatgctgggaattccaaccatccattcggacaacc
tttcagaaccttattgagggatttgaagcgcttctaaaataa

DBGET integrated database retrieval system