KEGG   Delphinapterus leucas (beluga whale): 111178524Help
Entry
111178524         CDS       T05885                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00020  Citrate cycle (TCA cycle)
dle00190  Oxidative phosphorylation
dle01100  Metabolic pathways
dle01200  Carbon metabolism
dle04714  Thermogenesis
dle04932  Non-alcoholic fatty liver disease (NAFLD)
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05016  Huntington disease
Module
dle_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dle_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dle_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111178524 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111178524 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    111178524 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111178524 (SDHA)
   05012 Parkinson disease
    111178524 (SDHA)
   05016 Huntington disease
    111178524 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    111178524 (SDHA)
Enzymes [BR:dle01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111178524 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 111178524
NCBI-ProteinID: XP_022436989
UniProt: A0A2Y9NPA3
LinkDB All DBs
Position
Unknown
AA seq 665 aa AA seqDB search
MSGIGVVSRLLRARRLALTWAQRREALHTGARSFHFTVDSSKRSSAKVSDAISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILVNSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLKHVGGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALGIAESCKPGD
KVPLIKPNAGEESVMNLDKLRFANGSIRTSELRLNMQKSMQSHAAVFRVGSVLQEGCEKI
SKLYGDLKHLKTFDRGMAWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKE
RVDEYDYSKPIQGQHKRPFEGHWRKHTLSYVDIRTGKVSLEYRPVIDRTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggatcggggttgtgtcgcggctgcttcgcgcccggcgcctagcgctgacctgg
gcgcagcggcgagaagcattgcacacaggagcccgcagttttcacttcaccgttgatagc
agtaagaggtcgtccgctaaagtttcagacgcaatttctacgcagtaccccgtagtggat
catgaattcgatgcagtggtggtcggcgccggaggggcaggcctgcgagctgcatttggc
ctttctgaagcagggtttaacacggcctgtgtcacaaagctctttcccaccaggtcacac
accgtcgcagcccagggagggatcaacgccgccctggggaacatggaggaggacaactgg
aggtggcacttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatc
cactacatgacggagcaggccccggcctccgtggtggagctggagaattacggcatgccg
tttagcagaactgaagatgggaagatctaccagcgtgccttcggtggacagagcctcaag
tttgggaagggcgggcaggcccatcggtgctgctgcgtggccgaccgcactggccactcg
ctgctgcacactttgtatggaaggtctctgcgatatgataccagctattttgtggagtat
tttgccttggatctcctgatggagaacggggagtgtcgaggcgttattgctctgtgcata
gaagacgggtccatccaccgcatcagagcaaagaacactgttgtagctactggaggctac
gggcgcacctacttcagctgcacatccgcccacaccagcaccggggacggcactgccatg
atcaccagggcaggccttccctgccaggacctggagtttgttcagttccaccctacaggc
atatacggtgctggctgtctcatcacggaagggtgccgtggagagggaggcatccttgtc
aacagtcaaggcgagaggttcatggagcgctatgctcctgtcgcaaaggacctggcatcc
agggacgtcgtatcccgctccatgaccctggagatccgtgaaggaagaggctgtggccct
gagaaggatcacgtgtacctgcagctgcatcacctccccccggaacagctggctatgcgc
ctgcctggcatctcggagacagccatgatcttcgcgggtgtggacgtcaccaaggagccg
atccccgtgcttcccaccgtgcactataacatgggcggcatccccaccaactacaagggg
caggttctgaagcacgtgggcggccaggaccaggtcgtgcccggcctgtacgcgtgtggg
gaggctgcctgcgcgtcagtgcacggcgccaaccggctgggggcgaactcgctcctggac
ctggtcgtcttcggccgggcgtgtgcgctgggaatcgcggagtcctgcaagcccggagat
aaagttcccttgattaaaccaaacgctggggaagaatctgtcatgaatcttgacaaattg
agatttgccaacggaagcataagaacatcggaactacggctgaacatgcagaagtcgatg
caaagtcatgccgcagtgttccgtgtgggaagcgtgttacaggaaggctgtgagaagatc
agcaagctctatggagatctaaagcatctgaagacgtttgacaggggaatggcctggaac
actgacctggtggagaccctggagctgcagaacctgatgctttgtgccctgcagaccatt
tacggagcagaggcccggaaggagtctcgcggcgctcatgccagggaggatttcaaggag
cgggttgacgagtacgattactccaagcccatccaggggcagcacaagaggccgtttgag
gggcactggaggaagcacacgctctcctatgtggacatcaggactgggaaggtctccctg
gaatacagacccgtaatcgacagaactttgaacgaggctgactgcgccactgtcccccca
gccatccgctcctactga

DBGET integrated database retrieval system