KEGG   Delphinapterus leucas (beluga whale): 111178690
Entry
111178690         CDS       T05885                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04141  Protein processing in endoplasmic reticulum
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05160  Hepatitis C
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111178690 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111178690 (BAK1)
   04215 Apoptosis - multiple species
    111178690 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178690 (BAK1)
   05202 Transcriptional misregulation in cancer
    111178690 (BAK1)
   05206 MicroRNAs in cancer
    111178690 (BAK1)
   05203 Viral carcinogenesis
    111178690 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111178690 (BAK1)
   05212 Pancreatic cancer
    111178690 (BAK1)
   05225 Hepatocellular carcinoma
    111178690 (BAK1)
   05226 Gastric cancer
    111178690 (BAK1)
   05214 Glioma
    111178690 (BAK1)
   05216 Thyroid cancer
    111178690 (BAK1)
   05220 Chronic myeloid leukemia
    111178690 (BAK1)
   05217 Basal cell carcinoma
    111178690 (BAK1)
   05218 Melanoma
    111178690 (BAK1)
   05213 Endometrial cancer
    111178690 (BAK1)
   05224 Breast cancer
    111178690 (BAK1)
   05222 Small cell lung cancer
    111178690 (BAK1)
   05223 Non-small cell lung cancer
    111178690 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    111178690 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111178690 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111178690 (BAK1)
   05160 Hepatitis C
    111178690 (BAK1)
   05164 Influenza A
    111178690 (BAK1)
   05162 Measles
    111178690 (BAK1)
   05168 Herpes simplex virus 1 infection
    111178690 (BAK1)
   05163 Human cytomegalovirus infection
    111178690 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111178690 (BAK1)
   05169 Epstein-Barr virus infection
    111178690 (BAK1)
   05165 Human papillomavirus infection
    111178690 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111178690 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dle03029]
    111178690 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dle02000]
    111178690 (BAK1)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    111178690 (BAK1)
Transporters [BR:dle02000]
 Other transporters
  Pores ion channels [TC:1]
   111178690 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 111178690
NCBI-ProteinID: XP_022437329
UniProt: A0A2Y9NQC8
LinkDB
Position
Unknown
AA seq 239 aa
MFREMVAHVGSPCRSWELDRPGGFSHCCSFFIWVPTPIRDLAPFSAHACPLSLGPALVSE
NTVGTTKEGGPRLGHLGEEPFAMSPGPSSPAAYRSLSTMGQVGRQLAIIGDDINRRYDSE
FQAMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLG
QVTRFVADFMLHHCIARWIAQRGGWVAALDLGNGPIRNVLIVLAVVLLGQFVVRRFFKS
NT seq 720 nt   +upstreamnt  +downstreamnt
atgttcagggagatggtggctcacgtggggtcaccatgcaggtcctgggagctggacagg
cctgggggtttttcccactgctgctcctttttcatatgggttcccacccccatccgggac
ctggcacccttttcagcacatgcctgccccttgtccctgggcccagccctcgtgtctgag
aacacggtcgggaccaccaaggaggggggcccaaggctggggcatctcggggaggagccc
ttcgccatgagcccaggccccagctcacctgctgcctaccgttccttgagcaccatgggg
caggtgggtcgccagctggccatcatcggggatgacatcaaccggcgctacgactccgag
ttccaggccatgttgcagcacctgcagccaacagcagagaatgcctatgagtatttcacc
aagatcgcctcaagcctgtttgagagcggcatcaactggggccgagtggtggctctgctg
ggctttggctaccgcctggccctccacgtctaccagcgcggcctgactggcttcctgggc
caggtgacccgcttcgtggccgacttcatgttgcatcactgcattgcccggtggatcgca
cagaggggtggctgggtggcagccctggacttgggaaacggtcccatccggaatgtgctg
atagttctggctgtggttttgttgggccagtttgtggtacgaagatttttcaagtcatga

DBGET integrated database retrieval system