KEGG   Delphinapterus leucas (beluga whale): 111178736
Entry
111178736         CDS       T05885                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04015  Rap1 signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04114  Oocyte meiosis
dle04218  Cellular senescence
dle04261  Adrenergic signaling in cardiomyocytes
dle04370  VEGF signaling pathway
dle04380  Osteoclast differentiation
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04670  Leukocyte transendothelial migration
dle04714  Thermogenesis
dle04722  Neurotrophin signaling pathway
dle04723  Retrograde endocannabinoid signaling
dle04728  Dopaminergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04912  GnRH signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04917  Prolactin signaling pathway
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05014  Amyotrophic lateral sclerosis
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05205  Proteoglycans in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111178736 (MAPK14)
   04015 Rap1 signaling pathway
    111178736 (MAPK14)
   04370 VEGF signaling pathway
    111178736 (MAPK14)
   04668 TNF signaling pathway
    111178736 (MAPK14)
   04068 FoxO signaling pathway
    111178736 (MAPK14)
   04071 Sphingolipid signaling pathway
    111178736 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111178736 (MAPK14)
   04218 Cellular senescence
    111178736 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111178736 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111178736 (MAPK14)
   04613 Neutrophil extracellular trap formation
    111178736 (MAPK14)
   04620 Toll-like receptor signaling pathway
    111178736 (MAPK14)
   04621 NOD-like receptor signaling pathway
    111178736 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    111178736 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    111178736 (MAPK14)
   04660 T cell receptor signaling pathway
    111178736 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    111178736 (MAPK14)
   04659 Th17 cell differentiation
    111178736 (MAPK14)
   04657 IL-17 signaling pathway
    111178736 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    111178736 (MAPK14)
   04670 Leukocyte transendothelial migration
    111178736 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111178736 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    111178736 (MAPK14)
   04917 Prolactin signaling pathway
    111178736 (MAPK14)
   04926 Relaxin signaling pathway
    111178736 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    111178736 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111178736 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    111178736 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    111178736 (MAPK14)
   04722 Neurotrophin signaling pathway
    111178736 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111178736 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111178736 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    111178736 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111178736 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111178736 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111178736 (MAPK14)
   05020 Prion disease
    111178736 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    111178736 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111178736 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111178736 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111178736 (MAPK14)
   05135 Yersinia infection
    111178736 (MAPK14)
   05133 Pertussis
    111178736 (MAPK14)
   05152 Tuberculosis
    111178736 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111178736 (MAPK14)
   05161 Hepatitis B
    111178736 (MAPK14)
   05171 Coronavirus disease - COVID-19
    111178736 (MAPK14)
   05163 Human cytomegalovirus infection
    111178736 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111178736 (MAPK14)
   05169 Epstein-Barr virus infection
    111178736 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111178736 (MAPK14)
   05140 Leishmaniasis
    111178736 (MAPK14)
   05142 Chagas disease
    111178736 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111178736 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111178736 (MAPK14)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111178736 (MAPK14)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111178736 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 111178736
NCBI-ProteinID: XP_022437448
UniProt: A0A2Y9P5K9
LinkDB
Position
Unknown
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccaaaacctgtccccggtgggctccggcgcctatggctccgtgtgtgct
gcttttgacacaaaaactgggttacgtgttgcagtgaagaagctgtccagaccatttcag
tccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgttttcacacctgcaaggtctctggaggaattcaat
gatgtgtacctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacggatgaccacgttcagttccttatctaccagattctccgaggtctcaagtat
atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcttggattttggactggctcgacatacagatgatgaaatgaca
ggctatgtagccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acactgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccaaagatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcagcg
caagcccttgcacatgcctactttgcccagtaccatgatcctgacgatgaaccagtggct
gatccttacgatcagtctttcgaaagcagggacctccttatagatgaatggaaaagcctg
acctacgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtct
tga

KEGG   Delphinapterus leucas (beluga whale): 111178738
Entry
111178738         CDS       T05885                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X2
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04015  Rap1 signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04114  Oocyte meiosis
dle04218  Cellular senescence
dle04261  Adrenergic signaling in cardiomyocytes
dle04370  VEGF signaling pathway
dle04380  Osteoclast differentiation
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04670  Leukocyte transendothelial migration
dle04714  Thermogenesis
dle04722  Neurotrophin signaling pathway
dle04723  Retrograde endocannabinoid signaling
dle04728  Dopaminergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04912  GnRH signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04917  Prolactin signaling pathway
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05014  Amyotrophic lateral sclerosis
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05205  Proteoglycans in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111178738 (MAPK13)
   04015 Rap1 signaling pathway
    111178738 (MAPK13)
   04370 VEGF signaling pathway
    111178738 (MAPK13)
   04668 TNF signaling pathway
    111178738 (MAPK13)
   04068 FoxO signaling pathway
    111178738 (MAPK13)
   04071 Sphingolipid signaling pathway
    111178738 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111178738 (MAPK13)
   04218 Cellular senescence
    111178738 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111178738 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111178738 (MAPK13)
   04613 Neutrophil extracellular trap formation
    111178738 (MAPK13)
   04620 Toll-like receptor signaling pathway
    111178738 (MAPK13)
   04621 NOD-like receptor signaling pathway
    111178738 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    111178738 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    111178738 (MAPK13)
   04660 T cell receptor signaling pathway
    111178738 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    111178738 (MAPK13)
   04659 Th17 cell differentiation
    111178738 (MAPK13)
   04657 IL-17 signaling pathway
    111178738 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    111178738 (MAPK13)
   04670 Leukocyte transendothelial migration
    111178738 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111178738 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    111178738 (MAPK13)
   04917 Prolactin signaling pathway
    111178738 (MAPK13)
   04926 Relaxin signaling pathway
    111178738 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    111178738 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111178738 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    111178738 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    111178738 (MAPK13)
   04722 Neurotrophin signaling pathway
    111178738 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111178738 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111178738 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    111178738 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111178738 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111178738 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111178738 (MAPK13)
   05020 Prion disease
    111178738 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    111178738 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111178738 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111178738 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111178738 (MAPK13)
   05135 Yersinia infection
    111178738 (MAPK13)
   05133 Pertussis
    111178738 (MAPK13)
   05152 Tuberculosis
    111178738 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111178738 (MAPK13)
   05161 Hepatitis B
    111178738 (MAPK13)
   05171 Coronavirus disease - COVID-19
    111178738 (MAPK13)
   05163 Human cytomegalovirus infection
    111178738 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111178738 (MAPK13)
   05169 Epstein-Barr virus infection
    111178738 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111178738 (MAPK13)
   05140 Leishmaniasis
    111178738 (MAPK13)
   05142 Chagas disease
    111178738 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111178738 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111178738 (MAPK13)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111178738 (MAPK13)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111178738 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 APH Kinase-like Kdo DUF4023
Other DBs
NCBI-GeneID: 111178738
NCBI-ProteinID: XP_022437455
UniProt: A0A2Y9NTT8
LinkDB
Position
Unknown
AA seq 366 aa
MNFTWKKGFYKQDVNKTAWELPKTYVSLTHVGSGAYGAVCSAIEKQSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQMDLQKIMGM
EFGEDKIQYLVYQMLKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARQADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPDAEFVQKLNDKAAKSYIQSLPQIPKKDFSQLFPHASPQAADLLEKMLELDMDKRLTAS
QALTHPFFESCRDPEEETEAHQPFDDFLEQEKLTVDGWKQHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaacttcacctggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccctgacgcacgtaggcagcggggcctacggcgccgtgtgc
tcagccatcgagaagcagtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtctgagatcttcgccaagcgggcctatcgcgagctgctgctgctgaagcacatgcag
cacgagaacgtcatcggactcctggatgtcttcaccccagcctcttccctgcgcaacttt
catgatttctacctggtgatgcccttcatgcagatggacctgcagaagatcatgggaatg
gagtttggtgaggacaagatccagtacctggtgtatcagatgctcaaaggtcttaagtac
atccactcagctggggtcatccacagggacctgaagccaggcaaccttgctgtcaatgag
gattgtgagctgaagattttggattttgggttggcacggcaagcagatgcagagatgact
ggctatgtggtgacccgctggtaccgggcccctgaggtgatcctcagctggatgcactac
aaccagactgtggacatctggtctgtgggctgtatcatggcagagatgctgacggggaaa
actctgttcaaggggaaagattacctggaccagctgacgcagatcctgaaagtgacgggg
gtgccggatgctgagtttgtgcagaagttgaatgacaaagcggccaaatcctacatccag
tccctgccacaaatccccaagaaggatttctctcagctcttcccgcatgccagcccccag
gctgcagacctgctggagaagatgctggagctggacatggacaagcgcctgaccgcctct
caggccctcacccaccccttctttgaatcctgccgggaccctgaggaggaaacagaggcc
catcagccatttgatgatttcttagaacaggagaaactcacagtggatggatggaagcag
cacatttacaaggagattgtgaacttcagccccatcgcccggaaggactctcggcgccgg
agtggcatgaagctgcagtga

KEGG   Delphinapterus leucas (beluga whale): 111186361
Entry
111186361         CDS       T05885                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04015  Rap1 signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04114  Oocyte meiosis
dle04218  Cellular senescence
dle04261  Adrenergic signaling in cardiomyocytes
dle04370  VEGF signaling pathway
dle04380  Osteoclast differentiation
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04670  Leukocyte transendothelial migration
dle04714  Thermogenesis
dle04722  Neurotrophin signaling pathway
dle04723  Retrograde endocannabinoid signaling
dle04728  Dopaminergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04912  GnRH signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04917  Prolactin signaling pathway
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05014  Amyotrophic lateral sclerosis
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05205  Proteoglycans in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111186361 (MAPK12)
   04015 Rap1 signaling pathway
    111186361 (MAPK12)
   04370 VEGF signaling pathway
    111186361 (MAPK12)
   04668 TNF signaling pathway
    111186361 (MAPK12)
   04068 FoxO signaling pathway
    111186361 (MAPK12)
   04071 Sphingolipid signaling pathway
    111186361 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111186361 (MAPK12)
   04218 Cellular senescence
    111186361 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111186361 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111186361 (MAPK12)
   04613 Neutrophil extracellular trap formation
    111186361 (MAPK12)
   04620 Toll-like receptor signaling pathway
    111186361 (MAPK12)
   04621 NOD-like receptor signaling pathway
    111186361 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    111186361 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    111186361 (MAPK12)
   04660 T cell receptor signaling pathway
    111186361 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    111186361 (MAPK12)
   04659 Th17 cell differentiation
    111186361 (MAPK12)
   04657 IL-17 signaling pathway
    111186361 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    111186361 (MAPK12)
   04670 Leukocyte transendothelial migration
    111186361 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111186361 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    111186361 (MAPK12)
   04917 Prolactin signaling pathway
    111186361 (MAPK12)
   04926 Relaxin signaling pathway
    111186361 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    111186361 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111186361 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    111186361 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    111186361 (MAPK12)
   04722 Neurotrophin signaling pathway
    111186361 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111186361 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111186361 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    111186361 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111186361 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111186361 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111186361 (MAPK12)
   05020 Prion disease
    111186361 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    111186361 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111186361 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111186361 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111186361 (MAPK12)
   05135 Yersinia infection
    111186361 (MAPK12)
   05133 Pertussis
    111186361 (MAPK12)
   05152 Tuberculosis
    111186361 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111186361 (MAPK12)
   05161 Hepatitis B
    111186361 (MAPK12)
   05171 Coronavirus disease - COVID-19
    111186361 (MAPK12)
   05163 Human cytomegalovirus infection
    111186361 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111186361 (MAPK12)
   05169 Epstein-Barr virus infection
    111186361 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111186361 (MAPK12)
   05140 Leishmaniasis
    111186361 (MAPK12)
   05142 Chagas disease
    111186361 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111186361 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111186361 (MAPK12)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111186361 (MAPK12)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111186361 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 111186361
NCBI-ProteinID: XP_022452591
UniProt: A0A2Y9Q525
LinkDB
Position
Unknown
AA seq 456 aa
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPNETLDDFTDFYLVMPFMGTDLGKLM
KHEKLSEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGETLFKGSDRILYLELGAG
EACPTPGAGCGGGLPYTCGEQARRTARAGWVGELCPTPGAGCGGGLPYTCGEQARRTARA
GWVGELCPLAPRCAPDLSQDLDQLKEIMKVTGTPPAEFVQRLQSAEAQNYMNGLPELEKK
DFAAILTNASPLAVNLLEKMLVLDAERRVTAAKALTHPYFESLHDTEDEPKAQKYDESFD
DVDRTLEEWKRVTYREVLSFKPPRQLGTKVSKETAL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcaagggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgtaggctcgggcgcctatggcgcc
gtgtgctcggcggtggacagccgcacgggcgccaaggtggccataaagaagctgtaccgg
cccttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccatgagaacgtaattgggctgctggatgtgttcacacccaatgagaccctggat
gatttcacagacttttacctggtgatgccgttcatgggcaccgacctggggaagctcatg
aagcacgagaagctgagtgaggaccgaatccagttcctcgtctaccagatgctcaagggg
ctgaagtacatccatgctgctggcatcatccacagggacctgaagcccggcaacctggcc
gtgaacgaggactgtgagctcaagatcctggactttggcctggcccggcaggcagatagc
gagatgactgggtacgtggtgacccggtggtaccgggcgcctgaggtcatcttgaattgg
atgcactacacacagacggtggacatctggtcagtgggctgcatcatggctgagatgatc
acaggggagacgctcttcaaaggcagcgaccgtatcctatacctggagctgggtgcgggg
gaggcttgccctacacctggagctgggtgcgggggaggcttgccctacacctgcggggag
caggccaggcgcactgcccgggctgggtgggtaggtgagctctgccctacacctggagct
gggtgcgggggaggcttgccctacacctgcggggagcaggccaggcgcactgcgcgggct
gggtgggtaggtgagctctgccctctggccccgcgctgtgctcctgacctcagccaagac
ctggaccagctgaaggaaatcatgaaggtgacggggacgcctcccgccgagttcgtgcag
aggctgcagagtgccgaggctcagaactacatgaatggcctccccgagctagagaaaaag
gattttgccgccatcctgaccaacgcaagccctctggctgtgaacctcctggagaagatg
ctcgtgctggatgcggagcggcgggtgacggcggccaaggcgctgacccacccctacttc
gagtcgctgcacgacacggaggacgagcccaaagctcaaaagtacgatgaatcctttgat
gacgtggaccgcacgctggaagagtggaagcgtgtcacatacagagaggtgctcagcttc
aagcctccccgacagctggggaccaaggtctccaaggagacggccctgtga

KEGG   Delphinapterus leucas (beluga whale): 111186364
Entry
111186364         CDS       T05885                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04015  Rap1 signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04114  Oocyte meiosis
dle04218  Cellular senescence
dle04261  Adrenergic signaling in cardiomyocytes
dle04370  VEGF signaling pathway
dle04380  Osteoclast differentiation
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04670  Leukocyte transendothelial migration
dle04714  Thermogenesis
dle04722  Neurotrophin signaling pathway
dle04723  Retrograde endocannabinoid signaling
dle04728  Dopaminergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04912  GnRH signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04917  Prolactin signaling pathway
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05014  Amyotrophic lateral sclerosis
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05205  Proteoglycans in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111186364 (MAPK11)
   04015 Rap1 signaling pathway
    111186364 (MAPK11)
   04370 VEGF signaling pathway
    111186364 (MAPK11)
   04668 TNF signaling pathway
    111186364 (MAPK11)
   04068 FoxO signaling pathway
    111186364 (MAPK11)
   04071 Sphingolipid signaling pathway
    111186364 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111186364 (MAPK11)
   04218 Cellular senescence
    111186364 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111186364 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111186364 (MAPK11)
   04613 Neutrophil extracellular trap formation
    111186364 (MAPK11)
   04620 Toll-like receptor signaling pathway
    111186364 (MAPK11)
   04621 NOD-like receptor signaling pathway
    111186364 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    111186364 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    111186364 (MAPK11)
   04660 T cell receptor signaling pathway
    111186364 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    111186364 (MAPK11)
   04659 Th17 cell differentiation
    111186364 (MAPK11)
   04657 IL-17 signaling pathway
    111186364 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    111186364 (MAPK11)
   04670 Leukocyte transendothelial migration
    111186364 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111186364 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    111186364 (MAPK11)
   04917 Prolactin signaling pathway
    111186364 (MAPK11)
   04926 Relaxin signaling pathway
    111186364 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    111186364 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111186364 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    111186364 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    111186364 (MAPK11)
   04722 Neurotrophin signaling pathway
    111186364 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111186364 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111186364 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    111186364 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111186364 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111186364 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111186364 (MAPK11)
   05020 Prion disease
    111186364 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    111186364 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111186364 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111186364 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111186364 (MAPK11)
   05135 Yersinia infection
    111186364 (MAPK11)
   05133 Pertussis
    111186364 (MAPK11)
   05152 Tuberculosis
    111186364 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111186364 (MAPK11)
   05161 Hepatitis B
    111186364 (MAPK11)
   05171 Coronavirus disease - COVID-19
    111186364 (MAPK11)
   05163 Human cytomegalovirus infection
    111186364 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111186364 (MAPK11)
   05169 Epstein-Barr virus infection
    111186364 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111186364 (MAPK11)
   05140 Leishmaniasis
    111186364 (MAPK11)
   05142 Chagas disease
    111186364 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111186364 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111186364 (MAPK11)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111186364 (MAPK11)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111186364 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 111186364
NCBI-ProteinID: XP_022452597
UniProt: A0A2Y9QAX2
LinkDB
Position
Unknown
AA seq 366 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDTRLRQRVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSLEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPHMPQKDLRSIFHGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKGGPEGCVPQRLSAACFLQEVLQ
FLLRVV
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgtcgggcccgcgcgccggcttctatcggcaggagctgaacaagacggtgtgggaggtg
ccgcagcggctgcaagggctgcgcccggtgggctcgggcgcctacggctccgtctgctca
gcctacgacacgcggctgcgccagagggtggcggtgaagaagctgtcgcgccccttccag
tcgctcatccacgcgcggaggacgtaccgcgagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggctgctggacgtgttcacgccggccacctccctcgaggacttcagc
gaagtgtacctggtgaccacgctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcagttcctcgtgtaccagctgctgcgcgggctgaagtac
atccactcggcggggatcatccaccgggacctgaagcccagcaacttggctgtgaacgag
gactgcgagctgcggatcctggactttgggctcgcgcgccaggcggacgaggagatgact
ggctacgtggccacgcgctggtaccgggcccctgagatcatgctgaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggccgagctgctccagggaaag
gcccttttcccaggaaatgactacatcgaccagctgaagcgcatcatggaggtggtgggc
acacccagccctgaggttctggcaaagatatcgtcggaacatgcccggacctacatccag
tccctgccccacatgccccagaaggacctcaggagcatcttccatggagccaaccccctg
gctgtggacctcctgggaaggatgctggtgctggacagtgaccagagggtcagtgcagcc
gaggccctggcccatgcctacttcagccagtaccacgaccccgatgatgagcccgaggcc
gagccctacgacgaaagcgttgaggccaaggagcgcacggtggaggagtggaagggtggg
cctgagggctgtgtcccccagaggctgagcgctgcctgttttctgcaggaagtgctccag
tttctcttgagagtggtctga

DBGET integrated database retrieval system