KEGG   Delphinapterus leucas (beluga whale): 111178743
Entry
111178743         CDS       T05885                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04012  ErbB signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle04630  JAK-STAT signaling pathway
dle04921  Oxytocin signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111178743 (CDKN1A)
   04630 JAK-STAT signaling pathway
    111178743 (CDKN1A)
   04066 HIF-1 signaling pathway
    111178743 (CDKN1A)
   04068 FoxO signaling pathway
    111178743 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    111178743 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111178743 (CDKN1A)
   04115 p53 signaling pathway
    111178743 (CDKN1A)
   04218 Cellular senescence
    111178743 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111178743 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    111178743 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178743 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    111178743 (CDKN1A)
   05206 MicroRNAs in cancer
    111178743 (CDKN1A)
   05205 Proteoglycans in cancer
    111178743 (CDKN1A)
   05203 Viral carcinogenesis
    111178743 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111178743 (CDKN1A)
   05212 Pancreatic cancer
    111178743 (CDKN1A)
   05225 Hepatocellular carcinoma
    111178743 (CDKN1A)
   05226 Gastric cancer
    111178743 (CDKN1A)
   05214 Glioma
    111178743 (CDKN1A)
   05216 Thyroid cancer
    111178743 (CDKN1A)
   05220 Chronic myeloid leukemia
    111178743 (CDKN1A)
   05217 Basal cell carcinoma
    111178743 (CDKN1A)
   05218 Melanoma
    111178743 (CDKN1A)
   05211 Renal cell carcinoma
    111178743 (CDKN1A)
   05219 Bladder cancer
    111178743 (CDKN1A)
   05215 Prostate cancer
    111178743 (CDKN1A)
   05213 Endometrial cancer
    111178743 (CDKN1A)
   05224 Breast cancer
    111178743 (CDKN1A)
   05222 Small cell lung cancer
    111178743 (CDKN1A)
   05223 Non-small cell lung cancer
    111178743 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111178743 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111178743 (CDKN1A)
   05161 Hepatitis B
    111178743 (CDKN1A)
   05160 Hepatitis C
    111178743 (CDKN1A)
   05163 Human cytomegalovirus infection
    111178743 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111178743 (CDKN1A)
   05169 Epstein-Barr virus infection
    111178743 (CDKN1A)
   05165 Human papillomavirus infection
    111178743 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111178743 (CDKN1A)
   01522 Endocrine resistance
    111178743 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111178743
NCBI-ProteinID: XP_022437464
UniProt: A0A2Y9NTU9
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSRDAHQIPRGSKACRRLFGPVDSEQLRRDCDALMASCVQEARERWNFDFVTETPLE
GDFAWERMRGLGLPKLYLPAGPRGTRDDLGGGKWPSTSSALLQGTSQEDHVDLSLSCTLV
PHSPERPEGSPGGPGTSQGRKRRQTSMTDFYHSKRRLISSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagagccatccagggatgcccatcagatcccacgcggcagcaaggcgtgccgccgc
ctctttggcccggtggacagtgagcagctgcgccgggactgcgacgccctgatggccagc
tgcgtgcaggaggcccgagagcgatggaacttcgactttgtcacggagacacctctggag
ggtgacttcgcctgggagcgcatgaggggccttggcctgcccaagctctacctgcctgca
gggccccgggggacccgggacgacctgggagggggcaagtggccgagcacctcatctgcc
ctgctgcaggggacatctcaggaggaccacgtggacctgtcactgtcctgcacccttgtg
cctcactccccagagcggcctgaggggtccccgggagggccgggcacctcccagggacga
aaacggcgacagaccagcatgacagatttctatcattctaaacgccggctgatcagctcc
aagaggaagccctaa

DBGET integrated database retrieval system