KEGG   Delphinapterus leucas (beluga whale): 111178754
Entry
111178754         CDS       T05885                                 

Gene name
PIM1
Definition
(RefSeq) serine/threonine-protein kinase pim-1 isoform X1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111178754 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178754 (PIM1)
   05206 MicroRNAs in cancer
    111178754 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111178754 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111178754 (PIM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111178754 (PIM1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111178754 (PIM1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   111178754 (PIM1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Choline_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 111178754
NCBI-ProteinID: XP_022437495
UniProt: A0A2Y9NTX7
LinkDB
Position
Unknown
AA seq 347 aa
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVAD
NLPVSGRPAAGRARRTGGARVCLARAREPNALWGAFQVAIKHVEKDRISDWGELPNGTRV
PMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARS
FFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRGELKLIDFGSGALLKDTVYTDFDGTRV
YSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHL
IRWCLALRPSDRPSFEEIQNHPWMQDVLLPQETAEIHLHSLLPGPSK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgctcttgtccaaaatcaactctcttgcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaagctggcgcccggcaaggagaaggagcccctggagtcacagtaccaggtg
ggcccgctcctgggcagtggcggcttcggctcggtctactcaggcatccgtgtcgccgac
aacttgccggtgagtgggcggcccgccgcggggagggcgcgccggacggggggcgcacgg
gtgtgtttggcccgggcgagggaacctaacgctctctggggggctttccaggtggccatc
aagcacgtggagaaggaccgcatttcagactggggagagctgcctaatggcacccgagtg
cccatggaagtggttctgctgaagaaggtgagctcgggcttctccggcgtcattaggctt
ctggactggttcgagaggcccgacagtttcgtcctgatcctggagaggcccgagccggtg
caagacctcttcgactttatcacggaaaggggggccctgcaggaggagctggcccgcagc
ttcttctggcaggtgctggaggccgtgcggcactgccacaactgcggggtgcttcaccgc
gacatcaaggacgagaacatccttatcgacctcagtcgcggcgagctcaagctcatcgac
ttcgggtcgggggcgctgctcaaggacaccgtctacacggacttcgatgggacccgagtg
tatagtcctccagagtggatccgctaccatcgctaccatggcaggtcggcagccgtctgg
tctctggggatcctgctgtacgatatggtctgtggagatattccctttgagcacgatgag
gagatcatcaggggccaagttttcttcaggcagagggtctcttcagagtgtcaacatctc
attagatggtgcttggccctgagaccatcagatcggccatcctttgaagaaatccagaac
catccgtggatgcaagatgtgctcctgccccaggaaactgctgagatccatctccacagc
ctgttgccagggcccagcaaatag

KEGG   Delphinapterus leucas (beluga whale): 111186679
Entry
111186679         CDS       T05885                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase pim-1-like
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04630  JAK-STAT signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111186679
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186679
   05206 MicroRNAs in cancer
    111186679
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111186679
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111186679
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111186679
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111186679
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   111186679
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 111186679
NCBI-ProteinID: XP_030618774
LinkDB
Position
Unknown
AA seq 387 aa
MLLSKSDCLARLRAAPCNDLHATKLAPGKEKEPLESQCQVGPLLGSGGFGSIYSGIRVTD
HLPVAIKTHVEKDCISGWGELPNGTRVPMEMVLLKKVSSGFPGVIRLLGWFERPSSFVLI
LDRPEPAQELFDFITERGALQAELAHSCFWQVLQAVRQCRSCGALHRDGKDENALIDLSR
GELKLIDFRSGAQLEDTVYTDFDGARAYSPPEWIRYHRYHGKSAAVWSLEILLXDMVCGD
VPFEHDEETIRGQVFFRQRVSSECQHLIRWCLALRPSDWPSFKEIQNHPWMQDVLLPQET
AEIHLHSLLPGPSRWLLGKFSLLCQMFKGGELCVSSFPSTSDTSLQVGQCLIQEQHLQLI
PDPRPWRPPPKERRRLHSSRPRPQLLP
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgctcttgtccaaatccgactgtcttgcccgcctgcgtgccgcgccctgcaacgacctg
cacgccaccaagctggcgcccggcaaggagaaggagcccctggagtcacagtgccaggtg
ggcccgctcctgggcagcggcggcttcggctccatctactccggcatccgtgtcactgac
cacttgccagtggccatcaagacgcacgtggagaaggactgtatttcaggctggggagag
ctgcctaacggcacccgagtgcccatggaaatggttctgctgaagaaggtgagctcgggc
ttccccggcgtcatcaggctcctgggctggttcgagagacccagcagtttcgtcctgatc
ctggacaggcccgagccagcgcaagaactcttcgactttatcacggaaaggggggccctg
caggcggagctggcccacagctgcttctggcaggtgctgcaggccgtgcggcagtgccgc
agctgcggggcgcttcaccgcgacggcaaggatgagaacgcccttatcgacctcagtcgc
ggtgagctcaaactcatcgacttcaggtcgggggcgcagctcgaggacaccgtctacacg
gacttcgatggggcccgagcatatagtcctccagagtggatccgctaccatcgctaccat
ggcaagtcagcagccgtctggtctctggagatcctgctgtaggatatggtctgtggagat
gttccctttgagcacgatgaggagaccatcaggggccaagttttcttcagacagagggtc
tcttcagagtgtcagcatctcattagatggtgcttggccctgagaccatcagattggcca
tccttcaaagaaatccagaaccatccatggatgcaagatgtcctcctgccccaggagact
gctgagatccatctccacagcctgttgccagggcccagcagatggcttctgggcaagttc
tcccttctctgtcagatgtttaagggaggggaactgtgtgtctccagcttcccaagtacc
agtgacacttctctccaagtaggacagtgcttgatacaggaacaacatttacaactcatt
ccagaccccaggccctggaggccgcctcccaaagagaggaggagactccactccagccgt
cctaggcctcagctcctcccatag

DBGET integrated database retrieval system