KEGG   Delphinapterus leucas (beluga whale): 111178866
Entry
111178866         CDS       T05885                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04066  HIF-1 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04370  VEGF signaling pathway
dle04510  Focal adhesion
dle04926  Relaxin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05219  Bladder cancer
dle05323  Rheumatoid arthritis
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111178866 (VEGFA)
   04014 Ras signaling pathway
    111178866 (VEGFA)
   04015 Rap1 signaling pathway
    111178866 (VEGFA)
   04370 VEGF signaling pathway
    111178866 (VEGFA)
   04066 HIF-1 signaling pathway
    111178866 (VEGFA)
   04020 Calcium signaling pathway
    111178866 (VEGFA)
   04151 PI3K-Akt signaling pathway
    111178866 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111178866 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111178866 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178866 (VEGFA)
   05206 MicroRNAs in cancer
    111178866 (VEGFA)
   05205 Proteoglycans in cancer
    111178866 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111178866 (VEGFA)
   05211 Renal cell carcinoma
    111178866 (VEGFA)
   05219 Bladder cancer
    111178866 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111178866 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111178866 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111178866 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111178866 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111178866 (VEGFA)
   05165 Human papillomavirus infection
    111178866 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111178866 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111178866 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111178866 (VEGFA)
Cytokines and growth factors [BR:dle04052]
 Growth factors
  Growth factors (RTK binding)
   111178866 (VEGFA)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111178866 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 111178866
NCBI-ProteinID: XP_022437714
UniProt: A0A2Y9NRE7
LinkDB
Position
Unknown
AA seq 214 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGEQKPHEVVKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMS
FLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSAPCGPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctgtacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggagagcagaaacctcacgaagtggtg
aagttcatggacgtctaccagcgcagctactgccgtccaattgagaccctggtggacatc
ttccaggagtaccccgatgagatcgagtacatcttcaagccgtcctgtgtgcccctgatg
cggtgtgggggctgctgcaatgacgagggtctggagtgtgtgcccaccgaagagttcaac
atcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatgagc
ttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaaggcaagaaaaa
aaatcagttcgaggaaagggaaaggggcaaaaaagaaagcgcaagaaatcccggtataaa
tcctggagcgctccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagat
ccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system