KEGG   Delphinapterus leucas (beluga whale): 111179217
Entry
111179217         CDS       T05885                                 

Gene name
NCK1
Definition
(RefSeq) cytoplasmic protein NCK1
  KO
K07365  NCK adaptor protein 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04360  Axon guidance
dle04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111179217 (NCK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111179217 (NCK1)
  09158 Development and regeneration
   04360 Axon guidance
    111179217 (NCK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dle04990]
    111179217 (NCK1)
Domain-containing proteins not elsewhere classified [BR:dle04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   111179217 (NCK1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 111179217
NCBI-ProteinID: XP_022438273
UniProt: A0A2Y9NTD8
LinkDB
Position
Unknown
AA seq 377 aa
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGHVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVSNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLIKHLS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcagaagaagtggtggtagtagccaaatttgattatgtggcccaacaagaacaagag
ctggacatcaagaagaatgagagattgtggcttctggatgattctaagtcctggtggcga
gttcgaaattccatgaataaaacgggttttgtgccttctaactacgtggaaaggaaaaac
agtgctcggaaagcatcgattgtaaaaaacctaaaggatacgttaggcattggaaaagtg
aaaagaaaacctagtgtgccagattctgcatctcctgctgatgatagctttgttgaccca
ggggaacgtctgtatgacctcaacatgcctgcttatgtaaaatttaactacatggcagag
agagaggatgaattgtcattgataaaagggacaaaggtgatcgtcatggagaaatgcagt
gatgggtggtggcggggtagctacaatggacatgttggatggttcccttcaaactatgtg
actgaggaaggcgacagtcctttgggtgaccatgtgggttctttgtcagagaaattagca
gcagtcgtcagtaacctaaatactgggcaagtgttacatgtggtacaggctctttaccca
ttcagctcgtccaatgatgaagaacttaattttgagaaaggcgatgtaatggatgttatt
gaaaaacctgaaaatgaccctgagtggtggaaatgcaggaagatcaatggaatggttggt
ctggtgccaaaaaactatgttaccattatgcagaataatccattaacctcaggtttggaa
ccatcgcctccacagtgtgattacattaggccttcactcactggaaagtttgctggcaat
ccatggtattatgggaaagtcaccaggcaccaagcagaaatggcattaaatgaaagaggg
catgaaggtgatttcctcattcgtgatagtgaatcttcgccaaatgatttttcagtatca
ctaaaagcacaagggaaaaacaagcattttaaagtccaactaaaagagactgtctactgc
attgggcagcgtaaattcagcaccatggaagaacttgtagaacattacaaaaaggcacca
atttttacaagtgaacaaggagaaaaattgtatcttatcaagcatttatcatga

KEGG   Delphinapterus leucas (beluga whale): 111187536
Entry
111187536         CDS       T05885                                 

Gene name
NCK2
Definition
(RefSeq) cytoplasmic protein NCK2
  KO
K19862  NCK adaptor protein 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04360  Axon guidance
dle04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111187536 (NCK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111187536 (NCK2)
  09158 Development and regeneration
   04360 Axon guidance
    111187536 (NCK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dle04990]
    111187536 (NCK2)
Domain-containing proteins not elsewhere classified [BR:dle04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   111187536 (NCK2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 111187536
NCBI-ProteinID: XP_022455005
UniProt: A0A2Y9QBN6
LinkDB
Position
Unknown
AA seq 376 aa
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGRTRRKTSARDASPTPSMDAEFPANGGGADRIYDLSIPAVVKF
AYAAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQVGWFPSNYVLEELDEAAADAPGGP
SLRPSAALSNGQGARVLHVVQTLYPFSSVTEEELNFDKGETMEVIEKPENDPEWWRCRNA
RGQVGLVPKNYVVVLSEGPALHAGSGPAGPARAGRFAGREWYYGNVTRHQAECALNARGV
QGDFLVRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVDHYKKAPI
FTSEHGEKLYLVRALQ
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgacagaggaggtcatcgtcatagccaagtgggactacacagcgcagcaggaccaggag
ctggacatcaagaagaacgagcgcctgtggctgctggacgactccaagacctggtggcgg
gtgcgcaacgcggccaacaggacgggctacgtgccgtccaactacgtggagaggaagaac
agcctgaagaagggctccctcgtgaagaacctcaaggacacgctcggcctcggcaggacc
cgcaggaagacaagtgcccgcgatgcatcgcccacacccagcatggacgcggagttcccc
gccaacggaggcggtgccgaccgcatctacgacctcagcatcccggccgtggtcaagttc
gcgtacgcggccgagcgcgaggacgagctgtcactggtgaagggctcgcgcgtcaccgtc
atggagaagtgcagcgacggctggtggcggggcagctacaacgggcaggtgggctggttc
ccatccaactacgtgctggaggagctggacgaggcggccgccgacgcgcccgggggcccg
agcctgcggcccagcgccgcgctcagcaacggccagggcgcgcgggtcctgcacgtggtg
cagacgctgtaccccttcagctcggtcaccgaggaggagctcaacttcgacaagggcgag
accatggaggtgatcgagaagcccgagaacgaccccgagtggtggcgctgccgcaacgcg
cgcggccaggtcggcctggtgcccaagaactacgtggtagtgctgagcgagggcccggcc
ctgcacgccggctctggccccgcggggcctgcgcgcgccggccggttcgcgggccgcgag
tggtactacgggaacgtgacgcgccaccaggccgagtgtgcgctcaacgcgcggggcgtg
cagggcgacttcctcgtccgcgacagcgagtcctcgcccagtgacttctccgtgtctctc
aaagcgtcagggaagaacaagcatttcaaggtgcaactggtggacaacgtctactgcatc
gggcagcggcgcttccacaccatggacgagctggtggatcactacaagaaggcccccatc
ttcaccagcgagcacggggagaagctctacctcgtccgggcgctgcagtga

DBGET integrated database retrieval system