KEGG   Delphinapterus leucas (beluga whale): 111179292
Entry
111179292         CDS       T05885                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor isoform X1
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04360  Axon guidance
dle04510  Focal adhesion
dle04520  Adherens junction
dle05100  Bacterial invasion of epithelial cells
dle05144  Malaria
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05211  Renal cell carcinoma
dle05218  Melanoma
dle05223  Non-small cell lung cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111179292 (MET)
   04014 Ras signaling pathway
    111179292 (MET)
   04015 Rap1 signaling pathway
    111179292 (MET)
   04020 Calcium signaling pathway
    111179292 (MET)
   04151 PI3K-Akt signaling pathway
    111179292 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111179292 (MET)
   04520 Adherens junction
    111179292 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    111179292 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111179292 (MET)
   05202 Transcriptional misregulation in cancer
    111179292 (MET)
   05206 MicroRNAs in cancer
    111179292 (MET)
   05205 Proteoglycans in cancer
    111179292 (MET)
   05230 Central carbon metabolism in cancer
    111179292 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111179292 (MET)
   05226 Gastric cancer
    111179292 (MET)
   05218 Melanoma
    111179292 (MET)
   05211 Renal cell carcinoma
    111179292 (MET)
   05223 Non-small cell lung cancer
    111179292 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111179292 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    111179292 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111179292 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111179292 (MET)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111179292 (MET)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  MET family
   111179292 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal Linker_histone Ninjurin
Other DBs
NCBI-GeneID: 111179292
NCBI-ProteinID: XP_022438435
UniProt: A0A2Y9NWP7
LinkDB
Position
Unknown
AA seq 1382 aa
MKAPAVLAPGILVLLFTLVQKSNGECKEALVKSKMNVNMQYQLPNFTAETPIQNVVSHKH
HIYLGAINYLYVLNDKDLQKVAEYKTGPVLEHPDCFPCQNCSHKANLSGGVWKDNINMAL
LVDTYYDDQLISCGSVHRGTCQRHVLPPDNTANIQSEVHCMYSPQADEEPSQCPDCVVSA
LGTKVLLSEKDRFINFFVGNTINSSYLPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFRDSYPIKYVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVSKPGTQLAKQIGANLNDDILYGVFAQSKPDSVEPMNR
SAVCAFPVKYVNEFFNKIVNKNNVRCLQHFYGPNHDHCFNRTLLRNSSGCEVRSDEYRTE
FTTALQRVDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGSLTPHVNF
LLDSHPVSPEAIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPSFVQCG
WCHDKCVRLEECPGGTWTQETCLPTIYKVFPTSAPLEGGTTLTICGWDFGFKRNNKFDLK
KTKVLLGNESCTLTLSESTINMLKCTVGPAMNEHFNMSIVISNSRGTVHYSTFSYVDPII
KSISPSYGPKTGGTLLTLTGKHLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQSTPTE
FPIKLKIDLANREMNSFIYREDPIVYEIHPTKSFVSGGSTITGVGKNLNSVSILRMVINV
HEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGIHSKYFDLIYVHNP
VFKPFENPVMISIGSKNVLEIKGNDIDPEAVKGEVLKVGNKSCENIQSHSEAVLCTVPND
LLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIVGVVSISIILLLLLGLFLWLKRRK
QIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
SCRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNVDGEG
DT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaaggcccctgctgtgcttgcacctggcatccttgtgcttctgtttaccttggtgcag
aagagcaatggggagtgtaaagaggcactagtaaagtccaagatgaatgtgaacatgcag
tatcagcttcctaacttcacagcagaaacacccattcagaatgtcgtttcccacaagcat
cacatttacctcggtgccattaactacctttacgttttaaatgacaaagaccttcagaag
gttgctgagtacaagactgggcctgtgctagaacacccagattgtttcccatgtcagaat
tgcagccacaaagccaatttatcaggtggtgtttggaaagataacatcaacatggctctg
cttgttgacacatactatgatgaccaactcattagctgcggcagtgtccacagagggacc
tgccagcgacacgtccttccacctgacaatactgctaacatacagtcggaggttcattgc
atgtactctccacaggcagatgaagagcccagccaatgtcctgactgtgtggtgagtgcc
ctgggaaccaaagtcctgctgtctgaaaaggatcgattcatcaacttcttcgtgggcaat
accataaattcttcttaccttccagatcattcattgcattcgatatctgtgagaaggcta
aaggaaacgcaagatggttttaagtttttgacagaccaatcctatattgatgttctacct
gagttccgagattcctaccccattaagtatgtccacgcctttgaaagcaaccattttatt
tactttttgacggtccagcgggaaactctagatgctcagacttttcacacaagaataatc
aggttctgttccgtagactctggtttgcattcgtacatggaaatgcctctggagtgtatt
ctcacagaaaagagaagaaagagatccacaagggaggaagtgtttaatattctccaagct
gcgtatgtcagtaagcctgggacccagctcgctaagcaaataggtgccaacctaaatgat
gatattctctacggggtgtttgcacaaagcaaaccagattccgtcgaaccaatgaatcgc
tctgctgtctgtgcgttccctgtcaaatatgtcaatgagttcttcaacaagatcgtcaac
aaaaacaatgtgagatgtctccagcatttttatggccccaaccacgaccactgcttcaat
aggacacttttgagaaattcatcaggctgcgaagtgcgcagtgatgaataccgaacggag
tttaccacagctttgcagcgcgttgacttattcatgggccagttcaaccaagtcctctta
acatctatatccacctttattaaaggagacctcaccatcgctaatcttggaacgtcagag
ggtcgattcatgcaggttgtggtttctcgatcaggatcattaaccccacacgtgaatttt
ctcctggattcccaccctgtgtctccagaagcaattgtggagcacccgctaaaccaaaat
ggctatacactcgttgtcactgggaagaagatcaccaagatcccgctgaatggcttgggc
tgtgaacatttccagtcctgcagtcagtgcctctccgccccttcctttgtgcagtgtggc
tggtgccatgataaatgtgtgcgattggaggaatgccctggtggaacatggactcaagag
acctgtctgcctacaatctacaaggttttcccaactagtgccccccttgaaggagggaca
acgctgaccatatgtggctgggactttggattcaagaggaataataaatttgacttgaag
aaaaccaaagttctccttggaaatgagagctgcaccttgaccttaagtgagagcacgata
aacatgttgaaatgcacagttggtcctgcaatgaatgaacatttcaatatgtccatagtt
atttcaaacagtcgagggaccgtacattatagtacattttcctatgtggatcctataata
aaaagtatttctccaagttatggtcctaaaactggtggcactttacttacgttaactgga
aagcacctaaacagtggaaattctagacacatttcaattggtggaaaaacatgtacttta
aaaagtgtttcagatagtattctcgaatgttataccccagcccaaagcactccaactgag
tttcctattaaattgaaaattgacttagccaaccgagagatgaacagcttcatttaccgg
gaagaccccattgtctatgaaatacatcccaccaaatcttttgttagtggtgggagcaca
ataacaggtgttggaaaaaacctgaattcagttagtatcctgaggatggtaataaatgtt
cacgaagcaggaaggaactttacggtggcatgtcagcatcgctctaattcggagataatc
tgctgtacaactccttcactacaacagctgaacctacaactccccctgaaaaccaaagcc
tttttcatgttagatgggatccattccaaatactttgatctcatttatgtacataatcct
gtgtttaagccttttgaaaatccagtgatgatctcaataggcagtaaaaatgtactggaa
attaagggaaacgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaat
aagagctgtgagaatatacagtcacattctgaagccgttttatgtacggtccccaatgac
ctgctgaaattgaacagcgaactaaatatagagtggaagcaagcaatttcttcaaccgtc
cttggaaaagtgatagttcaaccagatcagaatttcacaggactgattgttggtgttgtc
tcaatatcaataatactcttattattacttgggcttttcctgtggctgaaaaggagaaag
caaattaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcat
ttggataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaa
tctgtagactaccgagctacttttccagaagaccagtttcctaactcatctcagaatggg
tcatgcagacaagtgcagtatcctctgacagacctatcccccatcctaactagtggggac
tctgatatatccagtccattactgcaaaatactgtccacattgacctcagtgctctaaat
ccagagctggtccaggcagttcagcatgtagtgattgggccaagcagcctgattgtgcat
ttcaatgaagtcataggaagaggacatttcgggtgtgtatatcatgggactttgttggac
aacgatgataagaaaattcactgtgctgtgaaatccttgaatagaatcactgacatagga
gaagtttcccaatttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtt
ctctcgctcttgggaatctgccttcgaagtgaggggtctccactggtggtcctaccatac
atgaaacatggggatcttcgaaatttcattagaaatgagactcacaaccccactgtgaaa
gatcttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaag
tttgtccacagagacttggctgcaagaaactgtatgctggatgaaaaatttactgtcaaa
gttgctgattttggccttgccagagacgtgtatgataaggaatactatagcgtacacaac
aaaacaggtgcaaaactgccggtgaagtggatggctttagagagcctgcaaactcagaaa
tttaccaccaagtcagatgtgtggtcctttggcgtgctcctctgggaactgatgacaaga
ggagcaccaccttatcctgatgtcaacacctttgatataacagtatatttgttgcaaggc
agaaggctcctacaacctgaatactgcccagatcccttgtatgaagtgatgctgaaatgc
tggcaccctaaagctgaactgcgcccatccttttctgaactggtctccaggatatcagcg
atattctctactttcattggggagcactatgtccatgtgaacgctacatacgtgaatgtc
aaatgtgtcgctccatatccttctctgttgtcatcacaagataatgttgatggcgagggg
gatacatga

DBGET integrated database retrieval system