KEGG   Delphinapterus leucas (beluga whale): 111179463
Entry
111179463         CDS       T05885                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00562  Inositol phosphate metabolism
dle01100  Metabolic pathways
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04020  Calcium signaling pathway
dle04062  Chemokine signaling pathway
dle04064  NF-kappa B signaling pathway
dle04066  HIF-1 signaling pathway
dle04070  Phosphatidylinositol signaling system
dle04072  Phospholipase D signaling pathway
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04380  Osteoclast differentiation
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04625  C-type lectin receptor signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04670  Leukocyte transendothelial migration
dle04722  Neurotrophin signaling pathway
dle04750  Inflammatory mediator regulation of TRP channels
dle04919  Thyroid hormone signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05214  Glioma
dle05223  Non-small cell lung cancer
dle05225  Hepatocellular carcinoma
Module
dle_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111179463 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111179463 (PLCG2)
   04014 Ras signaling pathway
    111179463 (PLCG2)
   04370 VEGF signaling pathway
    111179463 (PLCG2)
   04064 NF-kappa B signaling pathway
    111179463 (PLCG2)
   04066 HIF-1 signaling pathway
    111179463 (PLCG2)
   04020 Calcium signaling pathway
    111179463 (PLCG2)
   04070 Phosphatidylinositol signaling system
    111179463 (PLCG2)
   04072 Phospholipase D signaling pathway
    111179463 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111179463 (PLCG2)
   04613 Neutrophil extracellular trap formation
    111179463 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    111179463 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    111179463 (PLCG2)
   04662 B cell receptor signaling pathway
    111179463 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    111179463 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    111179463 (PLCG2)
   04670 Leukocyte transendothelial migration
    111179463 (PLCG2)
   04062 Chemokine signaling pathway
    111179463 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    111179463 (PLCG2)
   04919 Thyroid hormone signaling pathway
    111179463 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111179463 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111179463 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    111179463 (PLCG2)
   04380 Osteoclast differentiation
    111179463 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111179463 (PLCG2)
   05206 MicroRNAs in cancer
    111179463 (PLCG2)
   05205 Proteoglycans in cancer
    111179463 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111179463 (PLCG2)
   05214 Glioma
    111179463 (PLCG2)
   05223 Non-small cell lung cancer
    111179463 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111179463 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111179463 (PLCG2)
   05171 Coronavirus disease - COVID-19
    111179463 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111179463 (PLCG2)
   05169 Epstein-Barr virus infection
    111179463 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111179463 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111179463 (PLCG2)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     111179463 (PLCG2)
Membrane trafficking [BR:dle04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    111179463 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    111179463 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like
Other DBs
NCBI-GeneID: 111179463
NCBI-ProteinID: XP_022438794
UniProt: A0A2Y9NXP3
LinkDB
Position
Unknown
AA seq 1265 aa
MSTTVNVDALPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETQQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEECCFTILYGTQFVLSTLSLAADSKEDAT
KWLSGLKILHQEVMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKLILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDVQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCLQQQRHMARV
FKEAFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEHRQQGE
LYMWDSIDQRWTRHYCAIADAKLSFSDDIEQTTEGEQPPDIAPTELHFGEKWFHKKVEKR
TSAEKLLQEYCAETGGKDGTFLVRESETYPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
LTDNLMFTSIYALIQHYSETHLRCAEFELRLTDPVPNPSPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMKLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEISPSMPQRTVKALYDY
KAKRNDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADGEDLEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDKVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSIVRQKPNDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
LQMNHALFSLNGRTGYVLQPESMRAEKYDPMPPESQRKILMTLTVKVLGARHLPKPGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATFPIKGIKSGFRSVPLKNGYSEDMELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRSANRDALVREFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgagcaccacggtcaacgtggacgcccttccggagtacgagaagagtcagatcaagagg
gccctggagctgggcacggtgatgacggtgttcagcttccgcaagtccaccccggagcgg
aggactgtccaggtgatcatggagacccagcaggtggcctggagcaagacggccgataag
atcgagggcttcctggatatcatggaaataaaggaaatccgcccagggaagaactccaag
gattttgagcgtgcgaaagcagtccgtcagaaggaagagtgctgcttcaccatcttgtat
ggcacccagttcgtcctcagcacgctcagcttagcagccgactctaaagaagatgcaact
aagtggctctctggcttgaagatcttgcaccaggaagtgatgaacgcatccacccccacc
atcattgagagttggttgcgaaagcagatttattctgtggatcagaccagaagaaacagc
atcagcctccgagagttgaagaccatcttgcccctggtcaacttcaaagtgagcagcgcc
aagttcctcaaagataagttcgtggaaataggagcacacaaagatgaactcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcagaaattgattcttgacgaa
ttcaaaaaggattcctccgtgttcatcttgggcaacaccgaccggccggatgcctccgct
gttcacctgcatgacttccagcggtttctcttacatgaacagcaggagctttgggcccag
gatctgaacaaagtccgtgagcggatgacaaagttcattgatgacacgatgagagaaact
gccgagcccttcctgtttgtggatgagttcctcacgtacctgttttcccgggagaacagc
atttgggatgagaagtatgacgtggtggatgtgcaggacatgaacaaccccttgtctcat
tactggatctcctcatcacataacacgtacctcacgggtgaccagcttcggagcgagtcg
tccccggaggcctatatccgctgtctgcggatgggctgccgctgcattgagctggactgc
tgggacgggcccgacgggaagcccatcatctaccacggctggacgcggaccaccaagatc
aagtttgatgacgtcgtgcaggccatcaaggaccatgcctttgtcacctcgagcttcccc
gtgatcctgtccatcgaggagcactgctgcctgcagcagcagcgccacatggccagggtg
ttcaaggaggcgttcggcgacctgctgctgaccaagcccacggaggccagtgccgaccag
ctgccgtcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggcgacgtggatgtcaacgtggaggacaagaaagatgaacacaggcagcagggtgaa
ctgtacatgtgggattccatcgaccagcgatggactcggcactactgcgccattgctgac
gccaagctgtccttcagcgacgacattgaacagactacggaaggtgaacagcccccggat
atagcccccacggagctgcattttggggagaagtggttccacaagaaggtggagaagagg
acaagcgccgagaagctgctgcaggaatactgcgccgagacggggggcaaggatgggacc
ttcttggtgcgggagagcgagacgtaccccaatgactacaccctgtccttctggcggtcg
ggccgcgtccagcactgccggatccgctccaccatggagggcgggaccctgaagtattac
ctgactgacaacctcatgttcaccagcatctatgccctcatccagcactacagcgagacg
cacctgcgctgtgccgagttcgagctccggctcaccgacccagttcccaaccccagcccg
cacgagtcgaagccgtggtactatgacgggctgagccgcggagaagcggaggacatgctg
atgagggttccccgggatggggccttcctgatccggaagcgggaaggttctgactcctac
gccatcaccttcagggccaggggcaaggtgaagcactgtcgcatcaaccgggacggccgg
cacttcgtgctgggcacctccgcctacttcgagagcctcgtggagctggtcagctactac
gagaagcacgcactctaccggaagatgaaactgcgctaccccgtgacccccgagctcctg
gagcgctacaatatggaaagagatataaactccctctatgatgtcagcaggatgtatgtg
gatcccagtgaaatcagcccttccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcgaaacgatgagctgagcttctgccgtggcgccctcatccacaatgtctcc
aaggagcctgggggctggtggaaaggagactacggaaccagaatccagcagtacttcccg
tccaattacgttgaagacatttcaacagctgacggggaggacctggaaaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatactggatctcaacacctataatgtt
gtaaaggccccacaggggaagaaccagaagcctttcgtctttatcttggagcccaagaag
cagggtgaccctccggtggagtttgccacagacaaggtggaggagctgtttgagtggttc
cagagcatccgggagatcacctggaagatcgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctcggacctggtcgtctactgcaaaccaacc
agcaagaccaaggacaacctagaaaaccccgacttccgagaaatccgctccttcgtggag
acaaaggctgacagcatcgtcagacagaaacccaacgatctcttgaaatacaatcaaaag
ggcctgacccgcgtttaccccaagggacagcgggtggactcctccaactacgaccccttc
cgcctctggctgtgtggctcccagatggtggcactcaatttccagacaccagataagtac
ctgcagatgaatcacgccctgttttccctcaatgggcggactggctacgtcctgcagccc
gagagcatgagggcggagaagtacgaccccatgccgcccgagtcccagaggaagatcctg
atgactctgacggtcaaggttctgggggctcgtcatctccccaaacctggacgaagtatt
gcatgtccctttgtggaggtggaaatatgcggagccgaatatgacaacaacaagttcaaa
acaacagttgtgaatgacaacggcctaagccctgtttgggctccgacacaggagaaggtg
acatttgaaatttatgacccaaacctcgcgtttctacgctttgtggtttacgaggaagat
atgttcagcgatcccaactttctcgcgcatgccactttccccattaaaggaatcaaatca
ggatttagatctgttcctctgaagaacggctacagtgaagacatggagctggcttccctc
ctggttttctgtgagatgcggccagtcctggagagcgaagaggagctttactcctcctgc
cgccagctgcggaggcggcaagaagaactgaacaaccagctctttctgtacgacacacac
cagaacttgcgcagcgccaaccgggatgccctggtcagagagttcaacgtcaacgagaac
cagctgcagctgtaccaggagaagtgcaaccgcaggttaagagagaagagagtcagcaac
agcaagttctactcatag

DBGET integrated database retrieval system