KEGG   Delphinapterus leucas (beluga whale): 111179595
Entry
111179595         CDS       T05885                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04015  Rap1 signaling pathway
dle04371  Apelin signaling pathway
dle04390  Hippo signaling pathway
dle04514  Cell adhesion molecules
dle04520  Adherens junction
dle05100  Bacterial invasion of epithelial cells
dle05200  Pathways in cancer
dle05213  Endometrial cancer
dle05216  Thyroid cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111179595 (CDH1)
   04390 Hippo signaling pathway
    111179595 (CDH1)
   04371 Apelin signaling pathway
    111179595 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111179595 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111179595 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111179595 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    111179595 (CDH1)
   05216 Thyroid cancer
    111179595 (CDH1)
   05218 Melanoma
    111179595 (CDH1)
   05219 Bladder cancer
    111179595 (CDH1)
   05213 Endometrial cancer
    111179595 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111179595 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111179595 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:dle04515]
    111179595 (CDH1)
   04090 CD molecules [BR:dle04090]
    111179595 (CDH1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111179595 (CDH1)
Cell adhesion molecules [BR:dle04515]
 Cadherins
  Major cadherins
   111179595 (CDH1)
CD molecules [BR:dle04090]
 Proteins
  111179595 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1
Other DBs
NCBI-GeneID: 111179595
NCBI-ProteinID: XP_022439058
UniProt: A0A2Y9P9K7
LinkDB
Position
Unknown
AA seq 885 aa
MGPLCRSLSALLLLLLLQVSSWLCQEPEPCNPGFGAESYTFTVPRLHLERGRVLGRVSFE
GCTGLPKTAYVSDDTRFKVGTDGVVTVKRPLHLRHPEMSFLVHAWDSTHRKLSTKVTLKA
VVHHHHHHHHHDSPSGTQTEVLTFPSSHHGLRRQKRDWVIPPISCPENEKGPFPKALVQI
KSNREKETKVFYSITGQGADTPPLHVFIIERETGWLKVTEPLDREDIAKYILFSHAVSSD
GQAIEEPMEIVITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVSATDADDDVNTYNA
AIAYTILSQEPTLPHNKMFTINKDTGVISVLTTGLDRESFPMYTLVVQAADLQGEGLSTT
ATAVITVNDTNDNPPIFNPTMYVGSVPENEANVVITTLTVTDADVPNTPAWEAVYTILND
NEKQFVVITDPETNEGVLKTAKGLDFEAKQQYILYVAVTNVAPFEVTLSTSTATVTVDVM
DVNEAPIFMPPQKKVTVPEDFGLGLEITSYTAQEPDRFMEQKITYRIWRDAANWLEINPD
TGAISTRAELDRENVDHVKNSTYTALIIATDDGSPPATGTGTLLLFLDDVNDNGPVPDPR
SMDFCQRDPQPLIINIIDPDLPPNTSPFTAELTHGASVNWTIEYNDQEHESLLFKPKKTL
EVGDYKINLKLIDNQNKDQVTTLDVHVCDCEGVVSNCWKVGPQAGAGLQVPAILGILGGI
LAFLILILLLLLLIRRRRVVKEPLLPPEDDTRDNIYYYDEEGGGEEDQEYDLSQLHRGLD
ARPEVTRNDVAPTLLSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEG
SGSEAASLSSLNSSESDQDQDYDYLNEWGSRFKKLADMYGGGEDD
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgggccctctgtgccgcagcctctctgcgctcctgctgctgctgctgctgcaggtctca
tcgtggctctgccaggagccggagccctgcaatcccggctttggcgccgagagctacacg
ttcaccgtgccccggctgcacttggagagaggccgagtcctgggcagagtgagttttgaa
ggatgcaccggtctaccaaagacagcctatgtttctgatgacacccgattcaaagtgggc
acagatggcgtggttacagtcaaacggcctttacaccttcgtcatccagagatgagtttt
cttgtccatgcctgggactccacccacaggaagctctccaccaaagtgaccctgaaggca
gtagtgcaccaccatcaccaccaccatcatcatgactctccctctggaacccagacagaa
gtgctcacatttcccagctcccaccatggtctcaggagacagaagagagactgggttatt
cctcctatcagctgcccagaaaatgagaaaggcccatttcctaaggctctggttcagatc
aaatctaacagggaaaaagaaaccaaagttttctacagcatcactggccaaggagccgac
acaccccctcttcatgtgtttattattgaaagagaaacaggatggctaaaggtgacggag
cctctggatagagaagatattgccaagtacattctcttctctcatgctgtgtcttcagac
gggcaagcaatcgaggagccgatggagattgtgatcaccgtgaccgatcagaatgacaac
aagcctgagttcacccaggaggtcttcaaagggtctgtcatggagggcgctcttccaggg
acctctgtgatggaggtctcggccacagacgcagacgatgatgtgaacacctacaacgct
gccattgcttacaccatcctcagccaagagcctacgctgccgcacaacaaaatgttcacc
atcaacaaggacacgggtgtcatcagtgtgctcaccaccgggctggaccgggagagtttt
cccatgtataccctggtggttcaagctgcagacctgcaaggtgaaggcttaagcacgacc
gcaacagctgtgatcacagtcaatgacaccaatgataaccctcccatcttcaacccaact
atgtacgtggggtcggtgcctgagaacgaggctaacgtggtcatcaccacactcacagtg
accgatgccgatgtccccaataccccagcgtgggaggccgtttacacaatattaaacgat
aacgagaagcagtttgttgtcatcacagacccagaaaccaatgaaggcgttttgaagacg
gctaagggcttggattttgaggccaagcagcagtacatcctgtatgtggcagtgactaat
gtggccccctttgaggtcactctctccacttccacagccaccgtcaccgtggacgtgatg
gatgtgaatgaagcccccatcttcatgcctcctcagaagaaagtgacagtgcccgaggac
ttcggcttgggcctggagatcacatcctacaccgcccaggagccagacagatttatggaa
cagaagatcacgtatcggatttggagggatgctgccaactggctggagattaatccggac
acgggtgccatttccactcgggctgagttggacagagagaacgtcgaccatgtgaagaac
agcacgtacacggccctcattatagccactgacgatggttctccacctgctactggaaca
ggaacgctgcttctattcctcgatgatgtgaatgacaatggccccgtaccagaccctcgg
agcatggacttctgccagagggatccacagcctctcatcatcaacatcattgatcctgat
cttccccccaacacttctcccttcacagcagaactaacacatggggcaagtgtcaactgg
accattgagtacaatgaccaagaacatgaatctctgctttttaagccaaagaaaacccta
gaggtgggtgactacaaaatcaatctcaagctcatagacaaccagaacaaagaccaagtg
accaccttagatgtgcacgtgtgtgactgtgaaggagttgtcagcaactgttggaaggtc
gggcctcaagctggagcaggattgcaagttcccgccattctggggattcttggaggcatt
cttgcttttctgatcctgattctgctgcttctgctacttattcggaggagaagggtagtc
aaagagcccttactgcccccagaagacgacacccgggacaacatttattactatgatgaa
gaaggaggtggagaagaagaccaggagtatgacctgagccagctacacaggggcctggat
gctcggcccgaagtgactcgcaatgatgtggcgccaaccctcctgagtgtgccccagtat
cgaccccgacctgccaatcctgatgaaattggaaactttattgatgaaaacctgaaggca
gctgatagtgaccccaccgccccaccctatgactctctgctggtgtttgattatgaagga
agcggctccgaagctgctagtctgagctccctgaattcctcggagtcagaccaagaccag
gattatgactacctgaacgagtggggcagtcgcttcaagaagctggcggacatgtatgga
ggcggcgaggatgactag

DBGET integrated database retrieval system