KEGG   Delphinapterus leucas (beluga whale): 111179654
Entry
111179654         CDS       T05885                                 

Gene name
TRADD
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04064  NF-kappa B signaling pathway
dle04071  Sphingolipid signaling pathway
dle04210  Apoptosis
dle04217  Necroptosis
dle04622  RIG-I-like receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04668  TNF signaling pathway
dle04920  Adipocytokine signaling pathway
dle05132  Salmonella infection
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111179654 (TRADD)
   04064 NF-kappa B signaling pathway
    111179654 (TRADD)
   04668 TNF signaling pathway
    111179654 (TRADD)
   04071 Sphingolipid signaling pathway
    111179654 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111179654 (TRADD)
   04217 Necroptosis
    111179654 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    111179654 (TRADD)
   04657 IL-17 signaling pathway
    111179654 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111179654 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111179654 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111179654 (TRADD)
   05152 Tuberculosis
    111179654 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111179654 (TRADD)
   05160 Hepatitis C
    111179654 (TRADD)
   05164 Influenza A
    111179654 (TRADD)
   05162 Measles
    111179654 (TRADD)
   05168 Herpes simplex virus 1 infection
    111179654 (TRADD)
   05163 Human cytomegalovirus infection
    111179654 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111179654 (TRADD)
   05169 Epstein-Barr virus infection
    111179654 (TRADD)
   05165 Human papillomavirus infection
    111179654 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death CARD_2 TPR_14
Other DBs
NCBI-GeneID: 111179654
NCBI-ProteinID: XP_022439217
UniProt: A0A2Y9P782
LinkDB
Position
Unknown
AA seq 315 aa
MAAGPNGLEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALRTALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFSGRQACGRFLRTYREGALRAALQGCLAAELTLHSVPLQLELRA
GAEQLDALLTDEERCLNCIFAQKPDRLRDEELTELEDALRNLTCGSGGQGGDVEGAPAPS
QSLAPSPSEEKPPPPPPPPSSGQTFLFHGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSL
QRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSL
AEDLLGLANPHGGLA
NT seq 948 nt   +upstreamnt  +downstreamnt
atggcggctgggccaaatgggctggaggagtgggtgggcagtgcctacctatttgtggag
tcctcgctggacaaggtggtcttgtcggatgcctacgctcacccgcagcagaaagtggcg
gtgtacagggctctgcggactgccctggcagagagtggcgggagccccgacgtgctgcag
atgctcaagatccaccgcagcgatccgcagctgatcgtgcagttgcgtttcagcgggcgc
caggcctgcggccgcttcctccgcacctaccgcgagggggcactgcgcgccgcgctgcaa
gggtgcttggcggcggagctgaccctgcactccgtgccgctgcaactggagctgcgcgcc
ggcgcggagcagctagatgccttgctgaccgacgaggagcgctgtttgaattgcatcttc
gcccagaagcccgaccggctccgggatgaggaactaacagagttggaggatgcgctcagg
aatctgacgtgcggctcggggggccaagggggcgacgtggagggcgctccggccccctcg
cagtctctggcaccctctccgtcggaggagaagccgccgccgccgccgccgccgccgtcg
tctggccagacttttctgttccatggtcagcccgtagtgaaccggccgctgagcctgcag
gaccaacagacgttcgcgcgctcagtgggcctcaagtggcgcaaggtggggcgctccttg
cagcgcggctgtcgtgcattgcgggacccggcgcttgactcactggcctatgaatacgag
cgtgaagggctgtatgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggc
cgccgcgccacgctgcagcgcctggtggaggcgctcgaggagaacgaactcaccagcctg
gcagaggacttgctgggcctcgcaaatccccatggcggcctggcctag

DBGET integrated database retrieval system