KEGG   Delphinapterus leucas (beluga whale): 111179772
Entry
111179772         CDS       T05885                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6 isoform X1
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04064  NF-kappa B signaling pathway
dle04120  Ubiquitin mediated proteolysis
dle04140  Autophagy - animal
dle04144  Endocytosis
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04722  Neurotrophin signaling pathway
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111179772 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111179772 (TRAF6)
   04064 NF-kappa B signaling pathway
    111179772 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111179772 (TRAF6)
   04140 Autophagy - animal
    111179772 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111179772 (TRAF6)
   04621 NOD-like receptor signaling pathway
    111179772 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    111179772 (TRAF6)
   04657 IL-17 signaling pathway
    111179772 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111179772 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111179772 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111179772 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111179772 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111179772 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111179772 (TRAF6)
   05135 Yersinia infection
    111179772 (TRAF6)
   05133 Pertussis
    111179772 (TRAF6)
   05152 Tuberculosis
    111179772 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111179772 (TRAF6)
   05161 Hepatitis B
    111179772 (TRAF6)
   05160 Hepatitis C
    111179772 (TRAF6)
   05171 Coronavirus disease - COVID-19
    111179772 (TRAF6)
   05162 Measles
    111179772 (TRAF6)
   05168 Herpes simplex virus 1 infection
    111179772 (TRAF6)
   05169 Epstein-Barr virus infection
    111179772 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111179772 (TRAF6)
   05140 Leishmaniasis
    111179772 (TRAF6)
   05142 Chagas disease
    111179772 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111179772 (TRAF6)
   04121 Ubiquitin system [BR:dle04121]
    111179772 (TRAF6)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111179772 (TRAF6)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    111179772 (TRAF6)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    111179772 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 Spc29 SlyX Tropomyosin_1 DUF3450 DUF4455 PspA_IM30 U-box AAA_13 RNase_Y_N DUF16 EzrA Med21 Spc7 UPF0242 PI3K_P85_iSH2 Laminin_II Myosin_tail_1 Tropomyosin DUF1664 ATG16 TMF_DNA_bd Sina CENP-F_leu_zip
Other DBs
NCBI-GeneID: 111179772
NCBI-ProteinID: XP_022439313
UniProt: A0A2Y9PAB2
LinkDB
Position
Unknown
AA seq 561 aa
MLLKIFLRRRKRAVDNHLTMSLLHWENSCGSSQSESDCCAAMAASSCGAAAKDESVSGTA
STVNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRD
AGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHRAHCEFALM
NCPQCQRPFQKCQLNIHIVKECPRRQVSCVNCAVSMAFEDKEIHDQNCPLANVICEYCNT
MLIREQMPNHYDLDCPTAPVPCTFSTFGCHEKMQRNHLARHLQEDTQSHMRMMAQAVQTL
SLAIAPAPQRGMLPCDSASLPRISSGCHSEVQNFQETIQQLEGRLVRQDHQIRELTAKME
TQSTYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFY
TGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAP
VRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVST
RFDMGSLRREGFQPRSTDLGI
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgctactcaaaatctttttgagaagaagaaaaagagcagtcgataatcaccttactatg
agtctgctacactgggaaaacagctgtggatccagccagtccgagagcgactgctgtgct
gccatggccgccagctcctgtggtgctgcagccaaagatgagagtgtgagtggaactgcc
agcacagtgaatctttccagctcttttatggaagagatccagggatatgacgtggaattt
gacccacccctggaaagcaagtatgaatgccccatctgcttgatggcattacgggaagca
gtgcaaacaccgtgcggccacaggttctgcaaagcctgcatcatcaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactctttcctgac
aattttgcaaaacgagagattctttctctgatggtgaagtgtccaaatgaaggttgtctg
cacaagatggaactgaggcatcttgaggatcaccgagcacattgtgagtttgctcttatg
aattgtccccaatgccaacgtcccttccaaaaatgccaacttaatattcacattgtcaag
gagtgtccaaggagacaggtttcttgtgtaaactgtgctgtatcgatggcatttgaagat
aaagagattcatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaacacc
atgctcatcagagaacagatgcctaatcattatgatctagactgtcctacagccccagtt
ccatgcacattcagtacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctgcaagaggatacccagtcgcacatgagaatgatggcccaggctgttcagacttta
agccttgcgatagctcccgcacctcagcgtggcatgctgccatgtgattctgcctctctg
ccccggatttcctctgggtgtcactcagaggtccagaatttccaagaaaccattcaacag
ttagagggtcgccttgtaagacaagaccatcaaatccgggagctgactgcaaaaatggaa
actcagagcacgtatgtaagtgagctaaaacgaactattcgaacccttgaggacaaagtt
gctgaaatagaagcacagcagtgcaatggaatttacatctggaagattggcaattttggg
atgcacttgaaatctcaagaagaggagaaacctgttgtcattcacagccccggattctac
acaggcaaacccggctacaaactatgcatgcgcctgcacctgcagctaccaactgcacag
cgctgtgccaactacatatccctcttcgtccacacgatgcaaggagagtatgacagccac
ctcccgtggcccttccagggtacgatacgccttaccatccttgatcagtctgaagcacct
gtaaggcaaaaccatgaagagataatggacgccaaaccagagctgcttgccttccagaga
cccacaatcccacggaaccccaaagggtttggctatgtgacctttatgcatctggaagcc
ctaagacaaagaaccttcatcaaggacgacacgttattagtacgctgtgaggtctccacc
cgctttgacatgggcagtcttcggagggagggttttcaaccacgaagtactgacttgggg
atatag

DBGET integrated database retrieval system