KEGG   Delphinapterus leucas (beluga whale): 111179781
Entry
111179781         CDS       T05885                                 

Gene name
CD44
Definition
(RefSeq) CD44 antigen isoform X3
  KO
K06256  CD44 antigen
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04512  ECM-receptor interaction
dle04640  Hematopoietic cell lineage
dle05169  Epstein-Barr virus infection
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111179781 (CD44)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111179781 (CD44)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111179781 (CD44)
   05205 Proteoglycans in cancer
    111179781 (CD44)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111179781 (CD44)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111179781 (CD44)
   04090 CD molecules [BR:dle04090]
    111179781 (CD44)
   00535 Proteoglycans [BR:dle00535]
    111179781 (CD44)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111179781 (CD44)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111179781 (CD44)
  Exosomal proteins of other body fluids (saliva and urine)
   111179781 (CD44)
  Exosomal proteins of colorectal cancer cells
   111179781 (CD44)
  Exosomal proteins of bladder cancer cells
   111179781 (CD44)
CD molecules [BR:dle04090]
 Proteins
  111179781 (CD44)
Proteoglycans [BR:dle00535]
 Cell surface proteoglycans
  Others
   111179781 (CD44)
Glycosaminoglycan binding proteins [BR:dle00536]
 Hyaluronan
  Cell surface receptors
   111179781 (CD44)
SSDB
Motif
Pfam: Xlink
Other DBs
NCBI-GeneID: 111179781
NCBI-ProteinID: XP_022439347
UniProt: A0A2Y9P7P5
LinkDB
Position
Unknown
AA seq 742 aa
MDTFWWRAAWGLCLVQLSLAQIDLNITCRYKGVFHVEKNGRYSISKTEAADLCKAFNCTL
PTMAQMEAALRAGFETCRYGFIDGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTDLPNAFEGPITITIVNRDGTRYTKKGEYRTNPDDINPSTTPEEDMSS
GSSSERSTSGGYNIFHTHLPTVYPTLDQDSPWVPSSPETTSATTLMSTSGTTSKTATKRQ
EAQDWFSWWFQPSASRIHLHTTTIMAGTDSNIISAGWEATEENEDESDRHPSYSGSDIDD
DEDFISSTISTTPRVFNHPQQNEDWTQPSPGHSNPEVSLQTTTRMTDVDRSSTSAYGEKW
TQETHSSLSHRGYHDEEETQHPTSTTRAPPTSTTEETATQKEQWFENGWPGEYPQMPKED
SHSTAGTTAASARDSHQNQRVTVQSQEDRSWTYFFDPVSHPMGRGHQTERRMDVDTSHST
TLQPSADPNTGLVEDLDRTGPLSVTTQQSDTQSFSTSRGGLEEDKDHPVTATPTSSNRND
GTGGRRGENLPEDSTTSVEGYTPYSPDTNEYRTLIPVTPAKTGSPEVTIVGDSTSNVDLS
LSEDQDSPHDPSERSYTTHGSESAGHSSGSQERGANTTSGPMRKPQIPEWLIILASLLAL
ALILAVCIAVNSRRRCGQKKKLVINNGNGTMEERKPSGLNGEASKSQEMVHLVNKESSET
PDQFMTADERRNLQNVDMKIGV
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggacacgttctggtggcgcgcagcctggggactctgcctcgtgcagctgagtttggcg
cagatcgatctaaatataacctgccgatacaaaggtgtattccacgtggagaagaatggt
cgctacagcatctcgaagactgaggctgctgacctctgcaaggccttcaattgtacactg
cccaccatggcccagatggaggcagccctgcgcgcagggtttgagacctgcaggtacggg
ttcatagatgggcacgtggtgatcccccggatccaccccaattccatctgtgctgcaaac
aacacgggagtgtacatccttacatccaatacctcccagtatgacacgtattgcttcaat
gcttcagctccacctgaagaagactgcacatcagtcacagacctgcccaatgcctttgaa
ggaccaattaccataactattgttaaccgtgatggcacccggtacaccaagaaaggggaa
tacagaactaaccccgatgacatcaaccccagcaccactcccgaggaggacatgagcagt
ggatcctccagtgagagaagcacttcagggggctacaacatcttccacacccatcttcca
accgtgtacccgaccctggaccaagatagtccctgggtccccagcagcccagagactacc
tcagctaccactttgatgagcactagtggtacaacttccaaaacagcaaccaagaggcaa
gaagcccaggattggttttcttggtggtttcagccatcagcatccaggattcatcttcac
accacaacaataatggctggtacggattcaaatatcatctcagcaggctgggaggcaact
gaagaaaatgaagatgaaagtgacagacaccccagttactctggatcagacattgatgat
gatgaagattttatctccagcaccatttcaaccacaccacgggtttttaaccacccacaa
cagaacgaggattggacgcaaccgagcccaggccattcgaatccagaagtatcacttcag
acaaccacaaggatgactgatgtggacagaagtagcaccagtgcttatggagaaaaatgg
acccaggaaacacactcttctctcagtcaccgtggatatcatgatgaagaggagacccag
catcctacaagcacaacccgggcaccccctactagtacaacggaagaaacagctacccag
aaagagcagtggtttgagaatggatggcctggggaatatccccaaatgccaaaagaagac
tctcattcaacagcagggacaactgcagcctcagcccgtgacagccatcaaaatcaaaga
gtgacagtgcagagccaagaggaccgttcctggacttatttcttcgacccagtctcacat
ccaatgggacgaggtcatcaaacagaaagaaggatggatgtggacaccagccatagtaca
acgcttcagccttctgcagatccaaacacaggtttggtggaagacttggacaggacagga
cctctttcagtgacaactcagcagagtgatactcagagcttctctacatcacgtggaggc
ttggaagaagacaaagaccatcccgtgactgctactccaacatctagcaataggaatgat
ggcacaggtggcagaagaggtgaaaatcttcctgaagactcaactacttcagtggaaggt
tatactccttattctccagacacaaatgaatacagaaccctcatcccagtgacccctgct
aagactgggtcccctgaagttactattgttggagattctacttctaatgttgatctttct
ttatcagaagaccaagactcaccccatgaccccagcgagaggtcctatacaactcatgga
tccgaatcagctgggcactcaagtgggagtcaggaacgtggggcaaacacaacctcaggt
cctatgcggaaacctcaaattccagaatggctgatcatcttggcatctctcctggccctg
gctttgattcttgcagtttgcatcgctgtcaacagtaggagaaggtgtgggcagaagaaa
aagctggtgatcaacaatggcaatggcacgatggaggagagaaagcccagcggactcaac
ggagaagctagcaagtctcaggagatggtgcatttggtgaacaaggagtcgtcagagacc
ccagaccagtttatgaccgcagatgagaggcggaacctgcagaatgtggacatgaagatt
ggggtgtaa

DBGET integrated database retrieval system