Delphinapterus leucas (beluga whale): 111180199 Help Entry 111180199         CDS       T05885                                  Gene name BCL2 Definition (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01521   EGFR tyrosine kinase inhibitor resistance dle01522   Endocrine resistance dle01524   Platinum drug resistance dle04064   NF-kappa B signaling pathway dle04066   HIF-1 signaling pathway dle04071   Sphingolipid signaling pathway dle04115   p53 signaling pathway dle04140   Autophagy - animal dle04141   Protein processing in endoplasmic reticulum dle04151   PI3K-Akt signaling pathway dle04210   Apoptosis dle04215   Apoptosis - multiple species dle04217   Necroptosis dle04261   Adrenergic signaling in cardiomyocytes dle04340   Hedgehog signaling pathway dle04510   Focal adhesion dle04621   NOD-like receptor signaling pathway dle04630   JAK-STAT signaling pathway dle04722   Neurotrophin signaling pathway dle04725   Cholinergic synapse dle04915   Estrogen signaling pathway dle04928   Parathyroid hormone synthesis, secretion and action dle04933   AGE-RAGE signaling pathway in diabetic complications dle05014   Amyotrophic lateral sclerosis dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05145   Toxoplasmosis dle05152   Tuberculosis dle05161   Hepatitis B dle05162   Measles dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05206   MicroRNAs in cancer dle05210   Colorectal cancer dle05215   Prostate cancer dle05222   Small cell lung cancer dle05226   Gastric cancer dle05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111180199 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     111180199 (BCL2)    04630 JAK-STAT signaling pathway     111180199 (BCL2)    04064 NF-kappa B signaling pathway     111180199 (BCL2)    04066 HIF-1 signaling pathway     111180199 (BCL2)    04071 Sphingolipid signaling pathway     111180199 (BCL2)    04151 PI3K-Akt signaling pathway     111180199 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111180199 (BCL2)   09143 Cell growth and death    04210 Apoptosis     111180199 (BCL2)    04215 Apoptosis - multiple species     111180199 (BCL2)    04217 Necroptosis     111180199 (BCL2)    04115 p53 signaling pathway     111180199 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     111180199 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     111180199 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     111180199 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     111180199 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     111180199 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     111180199 (BCL2)    04722 Neurotrophin signaling pathway     111180199 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111180199 (BCL2)    05206 MicroRNAs in cancer     111180199 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     111180199 (BCL2)    05226 Gastric cancer     111180199 (BCL2)    05215 Prostate cancer     111180199 (BCL2)    05222 Small cell lung cancer     111180199 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     111180199 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     111180199 (BCL2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     111180199 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     111180199 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     111180199 (BCL2)    05152 Tuberculosis     111180199 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111180199 (BCL2)    05161 Hepatitis B     111180199 (BCL2)    05162 Measles     111180199 (BCL2)    05168 Herpes simplex virus 1 infection     111180199 (BCL2)    05169 Epstein-Barr virus infection     111180199 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111180199 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     111180199 (BCL2)    01524 Platinum drug resistance     111180199 (BCL2)    01522 Endocrine resistance     111180199 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dle01009]     111180199 (BCL2) Protein phosphatases and associated proteins [BR:dle01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      111180199 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  111180199 NCBI-ProteinID:  XP_022440032 UniProt:  A0A2Y9P9P5 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGATSPGAAPAPGIFSSQPGSTPAPS RTSPPPPQTAPAAPARGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTA RGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLH TWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac tataagctgtcgcagaggggctacgagtgggatgccggagacgcgggcgccacgtccccg ggggccgcccccgcgccgggcatcttctcctcccagcctgggagcaccccagcgccatcc aggacctccccgccgccgccccagaccgctcccgccgcccccgccagggggcctgcgctc agccccgtgccacctgtggtccacctgaccctgcgccaggccggtgatgatttttctcgt cgctaccgccgcgacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcg aggggacgctttgccacggtggtggaggagctcttcagggatggagtaaactgggggagg atcgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatg tcccccctggtggacaacatcgccctgtggatgactgagtacctgaaccgacacctgcac acctggatccaggataacggaggctgggatgcctttgtggagctgtacggtcccagcatg cggcctctgtttgatttctcctggctgtctctgaaggcactgctcagtctggccctggtg ggagcttgcatcaccctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system