KEGG   Delphinapterus leucas (beluga whale): 111180199
Entry
111180199         CDS       T05885                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04064  NF-kappa B signaling pathway
dle04066  HIF-1 signaling pathway
dle04071  Sphingolipid signaling pathway
dle04115  p53 signaling pathway
dle04140  Autophagy - animal
dle04141  Protein processing in endoplasmic reticulum
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04261  Adrenergic signaling in cardiomyocytes
dle04340  Hedgehog signaling pathway
dle04510  Focal adhesion
dle04621  NOD-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04915  Estrogen signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05014  Amyotrophic lateral sclerosis
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05162  Measles
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05215  Prostate cancer
dle05222  Small cell lung cancer
dle05226  Gastric cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111180199 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    111180199 (BCL2)
   04630 JAK-STAT signaling pathway
    111180199 (BCL2)
   04064 NF-kappa B signaling pathway
    111180199 (BCL2)
   04066 HIF-1 signaling pathway
    111180199 (BCL2)
   04071 Sphingolipid signaling pathway
    111180199 (BCL2)
   04151 PI3K-Akt signaling pathway
    111180199 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111180199 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    111180199 (BCL2)
   04215 Apoptosis - multiple species
    111180199 (BCL2)
   04217 Necroptosis
    111180199 (BCL2)
   04115 p53 signaling pathway
    111180199 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111180199 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111180199 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    111180199 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    111180199 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111180199 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    111180199 (BCL2)
   04722 Neurotrophin signaling pathway
    111180199 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180199 (BCL2)
   05206 MicroRNAs in cancer
    111180199 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111180199 (BCL2)
   05226 Gastric cancer
    111180199 (BCL2)
   05215 Prostate cancer
    111180199 (BCL2)
   05222 Small cell lung cancer
    111180199 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111180199 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    111180199 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111180199 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111180199 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111180199 (BCL2)
   05152 Tuberculosis
    111180199 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111180199 (BCL2)
   05161 Hepatitis B
    111180199 (BCL2)
   05162 Measles
    111180199 (BCL2)
   05168 Herpes simplex virus 1 infection
    111180199 (BCL2)
   05169 Epstein-Barr virus infection
    111180199 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111180199 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111180199 (BCL2)
   01524 Platinum drug resistance
    111180199 (BCL2)
   01522 Endocrine resistance
    111180199 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111180199 (BCL2)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111180199 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 111180199
NCBI-ProteinID: XP_022440032
UniProt: A0A2Y9P9P5
LinkDB
Position
Unknown
AA seq 233 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGATSPGAAPAPGIFSSQPGSTPAPS
RTSPPPPQTAPAAPARGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTA
RGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLH
TWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 702 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggagacgcgggcgccacgtccccg
ggggccgcccccgcgccgggcatcttctcctcccagcctgggagcaccccagcgccatcc
aggacctccccgccgccgccccagaccgctcccgccgcccccgccagggggcctgcgctc
agccccgtgccacctgtggtccacctgaccctgcgccaggccggtgatgatttttctcgt
cgctaccgccgcgacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcg
aggggacgctttgccacggtggtggaggagctcttcagggatggagtaaactgggggagg
atcgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatg
tcccccctggtggacaacatcgccctgtggatgactgagtacctgaaccgacacctgcac
acctggatccaggataacggaggctgggatgcctttgtggagctgtacggtcccagcatg
cggcctctgtttgatttctcctggctgtctctgaaggcactgctcagtctggccctggtg
ggagcttgcatcaccctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system