KEGG   Delphinapterus leucas (beluga whale): 111180252
Entry
111180252         CDS       T05885                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04310  Wnt signaling pathway
dle04350  TGF-beta signaling pathway
dle04371  Apelin signaling pathway
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04659  Th17 cell differentiation
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05220  Chronic myeloid leukemia
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111180252 (SMAD4)
   04350 TGF-beta signaling pathway
    111180252 (SMAD4)
   04390 Hippo signaling pathway
    111180252 (SMAD4)
   04371 Apelin signaling pathway
    111180252 (SMAD4)
   04068 FoxO signaling pathway
    111180252 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111180252 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111180252 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    111180252 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111180252 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180252 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111180252 (SMAD4)
   05212 Pancreatic cancer
    111180252 (SMAD4)
   05225 Hepatocellular carcinoma
    111180252 (SMAD4)
   05226 Gastric cancer
    111180252 (SMAD4)
   05220 Chronic myeloid leukemia
    111180252 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111180252 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111180252 (SMAD4)
   05161 Hepatitis B
    111180252 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 111180252
NCBI-ProteinID: XP_022440174
UniProt: A0A2Y9NZ77
LinkDB
Position
Unknown
AA seq 553 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGG
DRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAG
RAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIA
PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEV
LHTMPIADPQPLD
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaaactgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcaccctagcaaatgtgttaccatacagagaacattggatgga
aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaacgaattaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccacctagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcattatccactgaagggcattcaattcaa
accatccagcatccaccaagtaatcgtgcatcgacggagacctacagcaccccagctctc
ttagccccatctgagtctaatgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtagaactgcaccatacacacctaatttg
cctcaccatcaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccgccagttcacaatgagcttgcattccagcctcccatttctaaccatcctgct
cctgagtattggtgttccattgcttactttgaaatggatgttcaagtaggagagacgttt
aaggttccttcaagctgtcctgttgttactgttgatggttatgtagacccttctggagga
gatcgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagca
aggttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtc
aggtgccttagtgaccacgcagtctttgtacagagctactacttagacagagaagctggg
cgtgcacctggagacgctgttcataagatctacccaagtgcatatataaaggtctttgat
ttgcgtcagtgtcatcgtcagatgcaacaacaggcagctactgcacaagctgcagcagct
gcccaggcagcagccgtggcaggaaacatccctggccccggatcagtaggtggaatagcc
ccagctatcagtttgtcagctgctgctggaatcggtgttgatgaccttcgtcgtttatgc
atactcaggatgagttttgtgaaaggctgggggcctgattacccaagacagagcatcaag
gaaacaccttgctggattgagattcacttacaccgggccctccagctcctagatgaagta
cttcacaccatgcctattgccgacccacagcctttagactga

DBGET integrated database retrieval system