KEGG   Delphinapterus leucas (beluga whale): 111180416
Entry
111180416         CDS       T05885                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04115  p53 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle04934  Cushing syndrome
dle05161  Hepatitis B
dle05162  Measles
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05215  Prostate cancer
dle05222  Small cell lung cancer
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111180416 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111180416 (CCNE2)
   04114 Oocyte meiosis
    111180416 (CCNE2)
   04115 p53 signaling pathway
    111180416 (CCNE2)
   04218 Cellular senescence
    111180416 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180416 (CCNE2)
   05206 MicroRNAs in cancer
    111180416 (CCNE2)
   05203 Viral carcinogenesis
    111180416 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    111180416 (CCNE2)
   05215 Prostate cancer
    111180416 (CCNE2)
   05222 Small cell lung cancer
    111180416 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111180416 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111180416 (CCNE2)
   05161 Hepatitis B
    111180416 (CCNE2)
   05162 Measles
    111180416 (CCNE2)
   05169 Epstein-Barr virus infection
    111180416 (CCNE2)
   05165 Human papillomavirus infection
    111180416 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dle03032]
    111180416 (CCNE2)
   03036 Chromosome and associated proteins [BR:dle03036]
    111180416 (CCNE2)
DNA replication proteins [BR:dle03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    111180416 (CCNE2)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    111180416 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111180416
NCBI-ProteinID: XP_022440480
UniProt: A0A2Y9P5H1
LinkDB
Position
Unknown
AA seq 404 aa
MSRRSSRLQAKQQPQPSQTDSPQETQIIQAKKRKTAQDVKKRKEEVIKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSQDVWLNMLKK
ETRYVHDKHFEVLHSELEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSREVVKKASGLEWDNISECVDWMVPFVSIVKSTSPVKLKVFKKISMEDRHNIQTH
TNYLAMLDEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaaacagcagccccagcccagtcagacggat
tccccacaagaaacccagataattcaggccaagaagagaaaaacggcccaggatgtcaaa
aaaagaaaagaggaggtcatcaagaaacatcagtatgagattaggaattgttggccacct
gtattatctggggggatcagtccttgcattatcattgaaacaccccacaaagaaatagga
acaagcgacttctccagatttacaaattacagatttaaaaatcttttcattaatccttca
cctttgcctgatttaagctggggatgttcacaggatgtttggctaaacatgttaaaaaaa
gagaccagatatgttcatgacaaacattttgaagttctgcattctgaattggaaccacag
atgaggtcaatacttctagactggcttttagaggtgtgtgaagtatacacacttcatagg
gaaacattttatcttgcgcaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaacatgcttcaactcattggaattacctcattattcattgcttccaaacttgag
gaaatctacgctcctaagctgcaagagtttgcttacgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgtcct
gtaacagtcatctcctggctaaatctcttcctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaaagttcattcaaatagctcagcttttagat
ctgtgtattcttgccatcgattcattagaattccagtacagaatactcgctgctgctgcc
ttgtgccattttacctctcgtgaagtggttaagaaagcctcaggtttggaatgggacaac
atttctgaatgtgtagactggatggtgccttttgtcagcatagtaaaaagtactagccca
gtgaagctgaaggtttttaagaagatttctatggaagacagacacaatatacagacacat
acaaattatctggctatgctggatgaagtaaattatataaacaccttcagaaagggggga
cagttgtcaccagtttgcaatggaggcattatgacaccaccgaagagcactgaaaaacca
ccaggaaaacactaa

KEGG   Delphinapterus leucas (beluga whale): 111180958
Entry
111180958         CDS       T05885                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04114  Oocyte meiosis
dle04115  p53 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle04934  Cushing syndrome
dle05161  Hepatitis B
dle05162  Measles
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05215  Prostate cancer
dle05222  Small cell lung cancer
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111180958 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111180958 (CCNE1)
   04114 Oocyte meiosis
    111180958 (CCNE1)
   04115 p53 signaling pathway
    111180958 (CCNE1)
   04218 Cellular senescence
    111180958 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180958 (CCNE1)
   05206 MicroRNAs in cancer
    111180958 (CCNE1)
   05203 Viral carcinogenesis
    111180958 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    111180958 (CCNE1)
   05215 Prostate cancer
    111180958 (CCNE1)
   05222 Small cell lung cancer
    111180958 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111180958 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111180958 (CCNE1)
   05161 Hepatitis B
    111180958 (CCNE1)
   05162 Measles
    111180958 (CCNE1)
   05169 Epstein-Barr virus infection
    111180958 (CCNE1)
   05165 Human papillomavirus infection
    111180958 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dle03032]
    111180958 (CCNE1)
   03036 Chromosome and associated proteins [BR:dle03036]
    111180958 (CCNE1)
DNA replication proteins [BR:dle03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    111180958 (CCNE1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    111180958 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C CBM_1 Connexin50
Other DBs
NCBI-GeneID: 111180958
NCBI-ProteinID: XP_022441590
UniProt: A0A2Y9P687
LinkDB
Position
Unknown
AA seq 410 aa
MPREKKERDGKEPGTMKEESGTDVSVRSRKRKANVAVFLQDPDEEVAKIDRTVRHQCGSQ
PWDSNTVCENPCSLIPTPDKEEDELVYPNSAYKPQSCTPSRASPLPVLNWANREEVWKIM
LNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDFYEVLLPQYPQHIFIQIAELLDLCVLDVGCLEFSYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQVKKAILSEENRISPLPTGVLTPPQSSKKQSGGQGTA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggaaaagaaggagagggatgggaaggaacccggcaccatgaaagaggaaagc
ggcaccgatgtctctgttcgctccaggaaaaggaaggcaaatgtggccgtttttttgcag
gatccagatgaagaagttgccaaaattgacaggaccgtgagacaccagtgtggcagtcag
ccttgggacagtaatacagtctgtgaaaacccctgttccttgattcccacacctgacaaa
gaagaggatgagctcgtatacccgaattctgcatataagcctcagagttgcacaccatct
agagcctcgccactgcctgtactgaactgggcaaatagagaggaagtatggaaaatcatg
ttaaacaaggaaaagacatacttgagggataagcactttatgcagcggcaccctcttctg
cagcctaaaatgcgagcgattcttctagattggttaatggaggtgtgtgaagtttataaa
cttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaacacaa
caaaatattgtaaaaacgcttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcttatgttacagatggggct
tgttcaggagatgaaattcttaccatggagttaatcattatgaaggcccttaagtggcat
ttaagtccgctgaccattgtgtcctggctgaatgtgtacatgcaggtcgcatatctaaat
gatttctatgaagtgctcctgccgcagtaccctcagcacatcttcatacagattgcagag
cttttagatctctgtgtcctggatgtcggctgcttagaattttcttatggggtacttgct
gcttctgccttgtatcatttctcttcatctgaattgatgcaaaaggtttcagggtatcag
tggtgtgatatagagaagtgtgtcaagtggatggttccatttgccatggttataagggaa
acaggaagttcaaaacttaagcacttcaggggagttcctgctgaagatgcacacaacatc
cagacccatataaacagcttggatttgctggacaaagcccaagtaaagaaagccatattg
tctgaagaaaataggatttctcctctccccactggggtcctcacccctccacagagcagt
aagaagcagagcggtgggcaaggaacagcatga

DBGET integrated database retrieval system