KEGG   Delphinapterus leucas (beluga whale): 111180640
Entry
111180640         CDS       T05885                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04071  Sphingolipid signaling pathway
dle04115  p53 signaling pathway
dle04141  Protein processing in endoplasmic reticulum
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04722  Neurotrophin signaling pathway
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111180640 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    111180640 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111180640 (BAX)
   04215 Apoptosis - multiple species
    111180640 (BAX)
   04217 Necroptosis
    111180640 (BAX)
   04115 p53 signaling pathway
    111180640 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111180640 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    111180640 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111180640 (BAX)
   05202 Transcriptional misregulation in cancer
    111180640 (BAX)
   05203 Viral carcinogenesis
    111180640 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111180640 (BAX)
   05212 Pancreatic cancer
    111180640 (BAX)
   05225 Hepatocellular carcinoma
    111180640 (BAX)
   05226 Gastric cancer
    111180640 (BAX)
   05214 Glioma
    111180640 (BAX)
   05216 Thyroid cancer
    111180640 (BAX)
   05220 Chronic myeloid leukemia
    111180640 (BAX)
   05217 Basal cell carcinoma
    111180640 (BAX)
   05218 Melanoma
    111180640 (BAX)
   05213 Endometrial cancer
    111180640 (BAX)
   05224 Breast cancer
    111180640 (BAX)
   05222 Small cell lung cancer
    111180640 (BAX)
   05223 Non-small cell lung cancer
    111180640 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111180640 (BAX)
   05014 Amyotrophic lateral sclerosis
    111180640 (BAX)
   05016 Huntington disease
    111180640 (BAX)
   05020 Prion disease
    111180640 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    111180640 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111180640 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111180640 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111180640 (BAX)
   05152 Tuberculosis
    111180640 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111180640 (BAX)
   05170 Human immunodeficiency virus 1 infection
    111180640 (BAX)
   05161 Hepatitis B
    111180640 (BAX)
   05160 Hepatitis C
    111180640 (BAX)
   05164 Influenza A
    111180640 (BAX)
   05162 Measles
    111180640 (BAX)
   05168 Herpes simplex virus 1 infection
    111180640 (BAX)
   05163 Human cytomegalovirus infection
    111180640 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111180640 (BAX)
   05169 Epstein-Barr virus infection
    111180640 (BAX)
   05165 Human papillomavirus infection
    111180640 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111180640 (BAX)
   01524 Platinum drug resistance
    111180640 (BAX)
   01522 Endocrine resistance
    111180640 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dle03029]
    111180640 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dle02000]
    111180640 (BAX)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    111180640 (BAX)
Transporters [BR:dle02000]
 Other transporters
  Pores ion channels [TC:1]
   111180640 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 111180640
NCBI-ProteinID: XP_022440840
UniProt: A0A2Y9P3X6
LinkDB
Position
Unknown
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQAPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPQLIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggggga
gagacacccgagctgggcctggagcaggcgccccaggatgcatccaccaagaagctgagc
gagtgtctcaagcgcattggagatgaactggacagtaacatggagctgcagaggatgatc
gcggccgtggacacagactccccccgagaggtctttttccgagtggcggccgaaatgttt
tctgacggcaacttcaactggggccgggttgtcgccctgttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgccccagctgatcaggaccatcatgggctggacc
ctggactttcttcgagagcggctgctgggctggatccaggaccagggtggttgggacggc
ctcctctcctactttgggacacccacgtggcagacagtgaccatcttcgtggccggagta
ctcactgcctcgcttaccatctggaagaagatgggctga

DBGET integrated database retrieval system