KEGG   Delphinapterus leucas (beluga whale): 111180676Help
Entry
111180676         CDS       T05885                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03030  DNA replication
dle03410  Base excision repair
dle03420  Nucleotide excision repair
dle03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111180676 (LIG1)
   03410 Base excision repair
    111180676 (LIG1)
   03420 Nucleotide excision repair
    111180676 (LIG1)
   03430 Mismatch repair
    111180676 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dle03032]
    111180676 (LIG1)
   03400 DNA repair and recombination proteins [BR:dle03400]
    111180676 (LIG1)
Enzymes [BR:dle01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111180676 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     111180676 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111180676 (LIG1)
DNA replication proteins [BR:dle03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111180676 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111180676 (LIG1)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111180676 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     111180676 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     111180676 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 111180676
NCBI-ProteinID: XP_022440921
UniProt: A0A2Y9PE99
LinkDB All DBs
Position
Unknown
AA seq 922 aa AA seqDB search
MQRSIMSFFQPKKEGKVKKPEKEISNSTRETESPPKVALKERNRVVPEGDSPVKRPGRKT
ARVLGSEGEDEEEEAPKPPKIQKRAPDSPQVSPPSPGTLPESSPSHSSTSPTVVSPSGIP
KRRTARKQLSKRTFQDVLQEQGKDEDGGTKKKRKEEEEEEEELETPTESLTEPEGGNKKE
AEEGDQPRSPPEPLKTSTKPPTESVSEPKVAVKQGPQEDGQAKPPPKAPKMLSSFFSPRK
PAIKQEAKEEGPSALRKDETKGHLDPSSYNPAKNNYHPVDDACWKVGQRVPYLAVARTFE
KIEEVSARLRMVETLSNLLRSVAALSPADLLPVLYLSLNRLGPPQQGLELGIGDGILLKA
VAQATGRQLESVRAEAAEKGDVGLVAESSRSTQRLMLPPPALTASGVFTKFRDIAQLAGS
ASTAKKMDVIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQEFP
PAVVDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGVERLPEHCTLSPG
VPLKPMLAHPTRGVSEVLRRFEEAAFTCEYKYDGQRAQIHVLEGGAVKIFSRNQEDNTAR
YPDIISRVHKIKLPSVTSFILDAEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCL
YAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTDQIAEFLEQSVKE
SCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGG
FLLAAYDEESEELQAICKLGTGFSDEELEEHHQTLQALVLPTPRSYVRADGAVAPDHWLD
PSAVWEVKCADLSLSPIYPAARGLVDSEKGISLRFPRFICVREDKKPEEATTSAQVACLY
RKQSQIQNQQGGEPDSDLEDFY
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtattatgtcatttttccagcccaagaaagagggcaaagtgaagaagcca
gagaaggagatatccaacagcaccagagaaacagagtcccctccaaaggtggcgctgaag
gagcggaatagagtggtacctgagggcgactctccagtgaagaggccagggaggaagacg
gcccgggtcctgggcagcgaaggggaggacgaggaggaggaagcccccaagccccccaaa
atccagaagcgtgctccagattccccacaagtctcccctcccagtcctggcacactgcct
gagagcagcccttcccactctagcacctctcccacggtcgtctccccgtcagggatcccg
aagcgtcgcacggcccggaagcagctttccaaacggacatttcaggatgtcctgcaagag
cagggcaaggacgaggacggaggaaccaagaagaagaggaaggaggaggaggaggaggaa
gaagaattagagacaccgacagaaagcctcacagagcctgaagggggcaacaagaaggaa
gcagaagaaggggaccagcccaggtcaccccctgagcccctgaagacctccacaaagccc
ccaacagaaagtgtttcagagcccaaggtggccgtgaagcagggaccacaggaggacggc
caggctaagcctccccccaaagctcccaagatgctcagcagtttcttctctccccggaag
ccagcaatcaaacaagaagcaaaagaagagggacccagcgctctgagaaaggacgagacc
aagggacacctggacccatccagctacaatcctgccaagaacaactaccatcccgtcgac
gatgcttgctggaaggtgggccagagagtcccttacctggctgtggcccggacgtttgag
aagatcgaagaggtttctgcgcggctccggatggtggagacactgagcaacctcctgcgc
tccgtggcggccctgtcacctgctgacctcctccctgtcctctacctcagcctcaaccgc
ctggggccgccccagcagggcctggagctcggcattggcgatggcatcctcctcaaggca
gtggcccaggccacaggccggcagctcgagtcggtccgggccgaggcggccgagaagggc
gacgtggggctggtggctgagagcagccgcagcacccagaggctcatgctgcccccgccc
gccctcaccgcctccggcgtcttcaccaagttccgggacatcgcgcagctggccggcagc
gcttccacagccaagaagatggacgtcatcaaaggcctctttgtggcctgccgccactca
gaagcacgattcatcgccagagccctgagtggacggctgcgcctcgggctggcagagcag
tcagtgctggcggccctcgcccaggctgtgagcctcaccccgccaggtcaagaattcccc
ccagccgtggtggatgctgggaagggcaagacagcagaggccagaaagacatggctggag
gagcaaggcatgatcctgaagcagacgttctgcgaggtgcccgacctggaccggattgtc
cccgtgttgctggagcacggtgtggagcggctcccagagcactgcacgctgagcccaggg
gtccccctgaaaccaatgttggcccacccaacccggggcgtcagcgaggtcctgaggcgc
tttgaggaggcagctttcacctgcgagtacaaatacgatgggcagagggcacagatccac
gttttggaaggcggggcggtgaagatcttcagcaggaaccaggaggacaataccgcgagg
taccccgatatcatcagccgtgtccacaagattaaactcccatcagtcacatccttcatc
ctggacgcggaagctgtggcttgggaccgggaaaagaagcagatccagccattccaagtg
ctcaccacccgcaaacgcaaggaggtggatgcggcagagatccaggtgcaggtgtgtctg
tacgccttcgacctcatctacctcaatggagagtccctggtacgtgagcccctttcccga
cgccggcagctgctccgggagaacttcgtggagacggagggcgagtttgtctttgccacc
tctctggacaccaaggacacggaccagatcgccgagttcttggagcagtcggtgaaagag
tcctgcgaggggctgatggtgaagaccctggatgtggacgccacctacgagatcgccaag
aggtcgcacaactggctcaagctgaagaaggactacctggacggcgtgggcgacaccctg
gacctcgtggtgataggcgcctacctgggccggggaaagcgggccggccggtacgggggc
ttcctgctggccgcctatgacgaggagagcgaggaactacaggccatatgcaagctcggg
acgggcttcagcgatgaggagctagaggagcatcaccagaccctccaggccctggtgctg
cccaccccacgctcctatgtccgggccgacggcgccgtggcccctgaccactggctggac
cccagcgccgtgtgggaggtgaagtgcgcagacctctccctctcccccatctacccggct
gcccggggcctggtggatagcgagaagggaatctccctccgcttccctcggttcatctgc
gtccgtgaggacaagaagccggaggaggccaccaccagtgcccaggtggcctgtctgtac
cggaagcaaagtcagattcagaaccagcaaggcggagagccagactccgacctggaagat
ttctactag

DBGET integrated database retrieval system