KEGG   Delphinapterus leucas (beluga whale): 111181001Help
Entry
111181001         CDS       T05885                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111181001 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111181001 (KMT5C)
Enzymes [BR:dle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111181001 (KMT5C)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111181001 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 111181001
NCBI-ProteinID: XP_022441690
UniProt: A0A2Y9P6I5
LinkDB All DBs
Position
Unknown
AA seq 455 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERRGEG
AFRLQPKEPLPPRPVDKYELRETKRRLQQGLDGPRACAHPPPLRRDLFCAACQPLRPPPC
GARPDASPLWLQWLPQPQLRVRPRRRRRPQPRRAPAPPVLRAARVSLHRWGGCGPHCCLR
AEALVALGPAARARWAPQQDWHWARRYGLPYVVRVDLSRVAPAPPATATPVPAGTPGPIP
IPKQALAFAPFSPPKRLRLVVSHGSIDLDVNGDGP
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggccccgacagagtgacagccagggaactgtgtgagaatgacgacctcgccaccagc
ctcgtcctggacccctacctcggcttccgcacccataagatgaacgtcagccccgtgccc
cccctgcggcgacagcaccacctgcgctcagcgctggaggccttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacatctatcgctacctccgagccttc
ctgcctgaaagcggcttcaccatcttgccctgtacccgttattccatggagacaaatgga
gccaagattgtgtctacccgcgcttggaaaaagaacgagaagttggagctgctggtgggc
tgcatcgcagagctgcgggaggcggacgaggggctgctgagggccggggagaatgacttc
agtatcatgtactccacccgcaagcgcagcgctcagctgtggctcggcccggccgccttc
atcaaccacgactgcaaacccaactgcaagttcgtacctgcagatgggaacgccgcctgc
gtgaaggtgctccgggacatcgagccaggggacgaggtgacctgcttctacggcgaaggc
ttcttcggtgaaaagaatgagcactgtgaatgctacacctgcgagaggagaggcgaagga
gctttccgactgcagcccaaggagcccctgccgccccggcccgtggacaagtatgagctc
cgggagacgaagcggcggctgcagcagggcctggatggcccccgggcctgtgcccaccca
cccccgctgcgccgggacctgttctgcgctgcctgccagcccctgcgccccccgccctgc
ggcgcccgccccgatgcctcacccctctggctccagtggctgcctcagccccagctccgg
gtgcgcccccggagacgccgacgcccccagccccggcgggccccggcaccccccgttctc
cgtgctgcccgcgtctccctgcaccgatggggaggctgtggcccccactgctgcctgcgg
gcagaggccctagtggctctggggccggccgcccgtgcccgctgggccccccagcaggac
tggcactgggcccggcgctacgggctgccttacgtggtacgtgtggatctgagccgtgtg
gccccggccccgcctgccactgccactcccgtccctgccgggaccccaggccccatcccc
atccccaagcaggcccttgcctttgcccccttctccccacccaagcgcctgcggctggtg
gtcagccatggctccatcgacctggatgtcaacggtgatgggccgtga

DBGET integrated database retrieval system